Text Search >
[2-(Methylamino)-5-nitrophenyl]methanol
Print…
You Searched For:
0 results were found
[2-(Methylamino)-5-nitrophenyl]methanol
Supplier:
Bachem Americas
Description:
Sequence: H-Asn(Trt)-OH
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042290-1G , MDL Number: MFCD01862937
Supplier:
Bachem Americas
Description:
Sequence: H-4-Cyano-Phe-OH
Catalog Number:
(10483-980)
Supplier:
Bioss
Description:
BOLA1 (BolA-like protein 1), also known as CGI-143, is a member of the BolA/yrbA family of proteins. Members of this family are homologs of the Escherichia coli protein, BolA. BolA-like proteins are evolutionarily conserved from prokaryotes to eukaryotes and are believed to play a role in cell-cycle regulation or cell proliferation possibly via some sort of transcription regulation of other genes. In addition, BolA-like proteins may contain nucleic-acid binding properties, as is suggested by a fold structure that is similar to the KH-fold, a motif known to participate in nucleic-acid binding. Characteristic of BolA-like proteins which typically consist of approximately 100 amino acids, BOLA1 is a 137 amino acid protein.
Supplier:
Thermo Scientific Chemicals
Description:
N(alpha)-Benzyloxycarbonyl-L-tryptophan Z-Trp-OH. Grade:99, Melting Point C124-126*. Boiling Point C:NA. C19H18N2O4. 7432-21-5. KEEP COLD
Catalog Number:
(103009-746)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN MW:3467.86 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
AMBEED, INC
Description:
(S)-2-((S)-2-Amino-3-methylbutanamido)propanoic acid, Purity: 97%, CAS Number: 27493-61-4, Appearance: White to off-white powder or crystals, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 100MG
Catalog Number:
(10289-588)
Supplier:
Bioss
Description:
Excitatory Amino Acid Transporters (EAATs) are membrane-bound proteins that are localized in glial cells and pre-synaptic glutamatergic nerve endings. EAATs transport the excitatory neurotransmitters L-glutamate and D-aspartate, a process that is essential for terminating the postsynaptic action of glutamate. The re-uptake of amino acid neurotransmitters by EAAT proteins has been shown to protect neurons from excitotoxicity, which is caused by the accumulation of amino acid neurotransmitters. EAAT4 is an aspartate/glutamate transporter that is expressed predominantly in the cerebellum. The transport activity encoded by EAAT4 has high apparent affinity for L-aspartate and L-glutamate, and has a pharmacologic profile consistent with previously described cerebellar transport activities. EAAT5 is a glutamate transporter coupled to a chloride conductance which is expressed primarily in retina. Although EAAT5 shares the structural homologies of the EAAT family, a novel feature of the EAAT5 sequence is a carboxy-terminal motif previously identified in N-ethyl-D-aspartate receptors and potassium channels and shown to confer interactions with a family of synaptic proteins that promote ion channel clustering.
Catalog Number:
(10451-968)
Supplier:
Bioss
Description:
Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier.
Supplier:
ALADDIN SCIENTIFIC
Description:
Heterobifunctional PEG derivative that can be used to modify proteins, peptides and other materials via amino or other acid reactive chemical groups. PEGylation can increase solubility and stability and reduce immunogenicity of peptides and proteins. It can also suppress the non-specific binding of charged molecules to the modified surfaces.
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 043220-500MG , MDL Number: MFCD01935943
Supplier:
MP Biomedicals
Description:
Guanosine is a purine nucleoside comprising guanine attached to a ribose (ribofuranose) ring via a β-N9-glycosidic bond. Guanosine can be phosphorylated to become guanosine monophosphate (GMP), cyclic guanosine monophosphate (cGMP), guanosine diphosphate (GDP), and guanosine triphosphate (GTP). These forms play important roles in various biochemical processes such as synthesis of nucleic acids and proteins, photosynthesis, muscle contraction and intracellular signal transduction (cGMP). When guanine is attached by its N9 nitrogen to the C1 carbon of adeoxyribose ring it is known as deoxyguanosine.
Guanosine is required for an RNA splicing reaction in mRNA, when a "self-splicing" intron removes itself from the mRNA message by cutting at both ends, re-ligating, and leaving just the exons on either side to be translated into protein. The antiviral drug aciclovir, often used in herpes treatment, is structurally similar to guanosine.
Supplier:
Promega Corporation
Description:
Recombinant human ROCK1 (amino acids 17-535) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. ROCK1 is a ubiquitously expressed serine-threonine kinase that is a downstream target of the small GTPase RhoA.
Supplier:
TCI America
Description:
CAS Number: 25102-12-9
MDL Number: MFCD00150036 Molecular Formula: C10H16N2O8 Molecular Weight: 368.42 Purity/Analysis Method: >98.0% (T) Form: Crystal Melting point (°C): 272
Catalog Number:
(103665-060)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mouse S100A4 (P07091)(Ala2-Lys101) was expressed and purified with two additional amino acids (Gly and Pro) at the N-terminus.
Catalog Number:
(89143-942)
Supplier:
Enzo Life Sciences
Description:
Isolated from stimulated human neutrophils. The secreted protein consists of 184 amino acids, six disulfide bonds and two glycosylation sites containing N-linked oligosaccharides.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
