Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-(1,3-Benzothiazol-2-yl)phenylamine


141,793  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"141793"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Anaspec Inc
Description:   PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4309.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: (76418-048)

Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli</i>. Contains 466 amino acids.
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-N-Me-Phe-OH
Supplier:  AMBEED, INC
Description:   Methyl 3-(2-(4-(adamantan-1-yl)phenoxy)acetamido)-4-hydroxybenzoate, Purity: 97%, CAS Number: 934593-90-5, Appearance: Form: Crystal - Powder/Colour: White - Pale reddish yellow, Storage: Inert atmosphere, 2-8 C, Size: 50mg
Supplier:  Bachem Americas
Description:   Sequence: H-β-(3-Benzothienyl)-Ala-OH
Supplier:  ALADDIN SCIENTIFIC
Description:   AT-406 ≥98%, Moligand™
New Product
Supplier:  Promega Corporation
Description:   Recombinant human InsR (amino acids 1011-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. InsR is the insulin receptor tyrosine kinase that is involved in insulin signaling.

Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli</i>. Contains 121/242 amino acids.
Supplier:  Promega Corporation
Description:   Recombinant human FLT1 (amino acids 784-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. FLT1, also known as fms-like tyrosine kinase 1, is a member of the VEGFR family and is related to the oncogene ROS.
Supplier:  AMBEED, INC
Description:   3-Aminopicolinamide, Purity: 98%, CAS Number: 50608-99-6, Appearance: White to Pale-yellow to Yellow-brown Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1g
Supplier:  AAT BIOQUEST INC
Description:   Aspartate aminotransferase (AST), also called serum glutamic oxaloacetic transaminase (GOT), is a member of transferase family.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Biotium
Description:   This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Supplier:  Biotium
Description:   This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Supplier:  Biotium
Description:   This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Supplier:  TCI America
Description:   CAS Number: 4998-57-6
MDL Number: MFCD00005208
Molecular Formula: C6H9N3O2
Molecular Weight: 155.16
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 286
MSDS SDS
Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli.</i> Contains 154 amino acids.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,409 - 3,424  of 141,793
Prev   1