Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"39979"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   Potent beta adrenergic antagonist
MSDS SDS

Supplier:  Adipogen
Description:   Human CD49d molecules are integrin alpha4 chains that are expressed as heterodimers with CD29 (beta 1 integrin) or (beta 7 integrin) and function as adhesion receptors. CD49d/CD29 is mainly expressed on thymocytes and B cells with increased expression on activated T cells. The ligands for CD49d/CD29 include VCAM-1 and fibronectin.
Small Business Enterprise
Catalog Number: (89151-596)

Supplier:  Enzo Life Sciences
Description:   DNA methyltransferase inhibitor
Supplier:  Biotium
Description:   This MAb reacts with a protein of 22 kDa, identified as β sub-unit of HCG. It does not cross react with the α sub-unit. HCG is a glycoprotein, which is secreted in large quantities by normal trophoblasts. It is present only in trace amounts in non-pregnant urine and sera but rises sharply during pregnancy. HCG is composed of two non-identical, non-covalently linked polypeptide chains designated as the alpha and beta subunits. The beta subunit is identical to that of thyroid stimulating hormone (TSH), follicle stimulating hormone (FSH), and luteinizing hormone (LH). hCG MAb detects cells and tumors of trophoblastic origin such as choriocarcinoma. Large cell carcinoma and adenocarcinoma of the lung demonstrate anti-hCG positivity in 90% and 60% of cases respectively. 20% of lung squamous cell carcinomas are positive. hCG expression by non-trophoblastic tumors may indicate aggressive behavior.
Supplier:  BIOGEMS INTERNATIONAL INC.
Description:   The HMb1-1 monoclonal antibody specifically reacts with mouse/rat CD29, a 130 kDA molecule also known as integrin beta 1, GPIIa, and the VLA-beta chain. It is expressed broadly on endothelial cells, epithelial, leukocytes, and smooth muscle. CD29 forms the VLA 1-6 complexes through the non-covalent interaction with the alpha integrins of CD49 a-f. The HMb1-1 antibody is capable of inhibiting T cell proliferation and blocking cell adhesion.
Catalog Number: (75788-688)

Supplier:  Prosci
Description:   Glia maturation factor beta (GMFB) contains a ADF-H domain,which is a member of the actin-binding proteins ADF family, GMF subfamily. It is a nerve growth factor implicated in nervous system development, angiogenesis and immune function. GMFB causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. It is phosphorylated after phorbol ester stimulation, and is crucial for the nervous system. GMFB overexpression in astrocytes results in the increase of BDNF production. GMFB expression is increased by exercise, thus BDNF is important for exercise-induction of BDNF.

Supplier:  AFG BIOSCIENCE LLC
Description:   Pig TGFb1 (Transforming Growth Factor Beta 1) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse Glycogen Synthase Kinase 3 Beta (GSK3B) ELISA Kit
Supplier:  AFG BIOSCIENCE LLC
Description:   Human CHRNb3 (Cholinergic Receptor, Nicotinic, Beta 3) ELISA Kit
Supplier:  AFG BIOSCIENCE LLC
Description:   Human CHRNb2 (Cholinergic Receptor, Nicotinic, Beta 2) ELISA Kit
Catalog Number: (10072-100)

Supplier:  Prosci
Description:   Both MIP-1 alpha and MIP-1 beta are structurally and functionally related CC chemokines. They participate in the host response to invading bacterial, viral, parasite and fungal pathogens by regulating the trafficking and activation state of selected subgroups of inflammatory cells e.g. macrophages, lymphocytes and NK cells. While both MIP-1 alpha and MIP-1 beta exert similar effects on monocytes their effect on lymphocytes differ; with MIP-1 alpha selectively attracting CD8+ lymphocytes and MIP-1 beta selectively attracting CD4+ lymphocytes. Additionally, MIP-1 alpha and MIP-1 beta have also been shown to be potent chemoattractants for B cells, eosinophils and dendritic cells. Both human and murine MIP-1 alpha and MIP-1 beta are active on human and murine hematopoietic cells. Recombinant murine MIP-1 alpha is a 7.8 kDa protein containing 69 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.
Supplier:  Thermo Scientific Chemicals
Description:   Dopamine beta-hydroxylase inhibitor
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 328-73-4
MDL Number: MFCD00040837
Molecular Formula: C8H3F6I
Molecular Weight: 340.01
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 172
Flash Point (°C): 74
Specific Gravity (20/20): 1.92
MSDS SDS
Supplier:  Anaspec Inc
Description:   Solid Aß (1-43) fibril is the most fibrillogenic of all the Aß peptides known.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Molecular Weight: 4615.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Bioss
Description:   Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. G gamma4 interacts with beta-1 and beta-2, but not with beta-3. It is expressed in brain, kidney, pancreas, skeletal muscle and faintly in cardiac muscle.

Supplier:  Novus Biologicals
Description:   Integrin beta 1/CD29 Polyclonal Antibody, Host: Goat, Conjugate: Biotin, Species: Mouse, Isotype: IgG, Immunogen: Chinese hamster ovary cell line CHO-derived recombinant mouse Integrin beta 1/CD29 Gln21-Ala738, Synonym: CD29 antigen, Application: WB, Size: 50ug
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,265 - 3,280  of 39,979