Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3-[1,1'-Biphenyl]-4-ylacrylic+acid


158,036  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"158036"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 037021-500MG , MDL Number: MFCD12027043
Supplier:  BeanTown Chemical
Description:   CAS: 26143-11-3; MDL No: MFCD00078041 Liquid; Linear Formula: W(OCH2CH3)5; MW: 409.15 Boiling Point: 110-115°/1 mmHg; Flash point: <gt/>110°C (<gt/>230°F) Moisture Sensitive
MSDS SDS
Catalog Number: (102893-334)

Supplier:  Matrix Scientific
MSDS SDS
Catalog Number: (103005-822)

Supplier:  Anaspec Inc
Description:   Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   (5aS,10bR)-2-Phenyl-4,5a,6,10b-tetrahydro-2H-indeno[2,1-b][1,2,4]triazolo[4,3-d][1,4]oxazin-11-ium tetrafluoroborate ≥98%, ee 99%
New Product

Supplier:  Rockland Immunochemical
Description:   Human Eotaxin AccuSignal ELISA Kit
Supplier:  Thermo Scientific Chemicals
Description:   250mg CAS: 605-91-4, MDL: MFCD00011975
MSDS SDS

Supplier:  LGC STANDARDS
Description:   11-Keto Oxcarbazepine, TRC, LGC Standards
New Product
Supplier:  AMBEED, INC
Description:   Nevirapine 98%
New Product
Supplier:  AMBEED, INC
Description:   (SP-5-13)-(Acetato-KO)[[2,2'-[(1S,2S)-1,2-cyclohexanediylbis[(nitrilo-KN)methylidyne]]bis[4,6-bis(1,1-dimethylethyl)phenolato-KO]](2-)]cobalt, Purity: 97%, CAS Number: 211821-53-3, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 1G
Supplier:  AMBEED, INC
Description:   4-(Diphenylmethylene)-1,1-dimethylpiperidin-1-ium methyl sulfate, Purity: 98%, CAS Number: 62-97-5, Appearance: Form: Crystal - Powder / Colour: White - Almost white, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 50MG
Supplier:  Strem Chemicals Inc
Description:   BINAP
Supplier:  Novus Biologicals
Description:   Cadherin-11 Overexpression Lysate (Adult Normal)
Catalog Number: (76734-642)

Supplier:  ANTIBODIES.COM LLC
Description:   Human IL-11 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human IL-11 in serum, plasma, tissue homogenates, and other biological fluids.
Supplier:  TCI America
Description:   CAS Number: 5551-11-1
MDL Number: MFCD00056104
Molecular Formula: C7H4ClNO3
Molecular Weight: 185.56
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 68
MSDS SDS

Supplier:  Abnova
Description:   Rabbit polyclonal antibody raised against 11-ketotestosterone.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,817 - 6,832  of 158,036