Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3-Amino-5-methylpyridine-2-carboxylic+acid+amide


171,533  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"171533"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  GE Healthcare - Life Sciences
Description:   EAH Sepharoseâ„¢ 4B allows for the stable carbodiimide-based coupling of carboxyl groups to Sepharose® 4B via an 11-atom hydrophilic spacer arm that permits extremely stable coupling.
MSDS SDS
Product available on GSA Advantage®
Supplier:  Anaspec Inc
Description:   Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4534.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Anaspec Inc
Description:   This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4761.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Anaspec Inc
Description:   This amino acids 22 to 27 fragment is a modification of the human islet amyloid polypeptide hIAPP (NFGAIL) with N-methylation of the amide bonds at G24 and I26. The introduction of two N-methyl rests in the amyloid-core-containing sequence NFGAIL converts this amyloidogenic and cytotoxic sequence into non-amyloidogenic and non-cytotoxic peptide. The peptide is able to bind with high-affinity full-length hIAPP and to inhibit its fibrillogenesis.
Sequence: NF-(NMe-G)-A-(NMe-I)-L
Molecular Weight: 661.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (77081-542)

Supplier:  AMBEED, INC
Description:   Ethyl 6-methylpyridine-3-carboxylate 97%
Supplier:  Thermo Scientific Chemicals
Description:   1g CAS: 150190-03-7, MDL: MFCD09953494
MSDS SDS
Supplier:  AOB CHEM USA
Description:   Methyl 6-butoxy-5-methylpyridine-3-carboxylate ≥97%
Supplier:  AOB CHEM USA
Description:   Methyl 2-fluoro-5-methylpyridine-3-carboxylate ≥97%
Supplier:  AMBEED, INC
Description:   Ethyl-2,4-dichloro-6-methylpyridine-3-carboxylate 98%
New Product
Supplier:  AOB CHEM USA
Description:   Ethyl 2-fluoro-3-methylpyridine-4-carboxylate ≥97%
Supplier:  MP Biomedicals
Description:   Flavin Adenine Dinucleotide is a prosthetic group of certain oxidases.
Flavin adenine dinucleotide (FAD) is used as a redox cofactor (electron carrier) by flavoproteins including succinate dehydrogenase (complex), α-ketoglutarate dehydrogenase, apoptosis-inducing factor 2 (AIF-M2, AMID), folate/FAD-dependent tRNA methyltransferases, and N-hydroxylating flavoprotein monooxygenases. FAD is a component of the pyruvate dehydrogenase complex.
Store at -0 °C.
Supplier:  AOB CHEM USA
Description:   Ethyl 6-methoxy-2-methylpyridine-3-carboxylate ≥97%
New Product
Supplier:  Adipogen
Description:   Efficient coupling reagent for the synthesis of sterically hindered amides, especially peptides. In terms of reactivity and racemization-suppressing capability, this pyridinium-type reagent, BEP, proved to be more efficient than commonly used uronium- and phosphonium-type reagents, such as HBTU, BOP, and PyBroP, for the synthesis of hindered peptides containing N-methylated or Calpha,Calpha-dialkylated amino acid residues. BEP was also proven to be an efficient reagent for the synthesis of esters, especially active esters and hindered esters, and tert-butyl esters.
Catalog Number: (76823-008)

Supplier:  AMBEED, INC
Description:   Ethyl 3-Methylpyridine-2-carboxylate, Purity: 97%, CAS Number: 58997-10-7, Appearance: Colorless or white to yellow liquid or powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 1G
Supplier:  BeanTown Chemical
Description:   CAS: 1721-26-2; EC No: 217-013-4; MDL No: MFCD00006336 Liquid; Molecular Formula: C9H11NO2; MW: 165.19 Boiling Point: 126-127°/24 mmHg; Flash point: 103°C (217°F) Density (g/mL): 1.072; Refractive Index: 1.505
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C9H11NO2 MW=165.19 CAS=25635-17-0 MDL=MFCD09746244 500MG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
353 - 368  of 171,533
Prev   23  24  25  26  27  28  29  30  31  32  33  34  35  36  37  38  Next