Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"22352"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Biolegend
Description:   Alexa Fluor® 647 anti-mouse H-2Kd [SF1-1.1]; Isotype: Mouse (SJL) IgG2a, κ; Reactivity: Mouse d haplotype, Weakly cross-reacts with H-2k haplotype, Does not cross react with other haplotypes (e.g., b, j, p, q, s, v).; Apps: FC; Size: 100 μg
Supplier:  AMBEED, INC
Description:   tert-Butyl ((5-bromopyridin-2-yl)methyl)carbamate, Purity: 97%, CAS Number: 1188477-11-3, Appearance: White to Yellow to Brown Solid, Storage: Sealed in dry, 2-8C, Size: 100MG

Supplier:  Anaspec Inc
Description:   This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Novus Biologicals
Description:   Importin 11 Overexpression Lysate (Adult Normal)
Supplier:  AMBEED, INC
Description:   2-Nitroisophthalic acid, Purity: 98%, CAS Number: 21161-11-5, Appearance: Form: Crystal - Powder/Colour: White - Pale yellow, Storage: Sealed in dry, Room Temperature, Size: 500g
Supplier:  AMBEED, INC
Description:   6-Chloro-3-(dichloromethyl)-3,4-dihydro-2H-benzo[e][1,2,4]thiadiazine-7-sulfonamide 1,1-dioxide, Purity: 98%, CAS Number: 133-67-5, Appearance: Form: Crystal - Powder / Colour: White - Almost white, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 250MG
Catalog Number: (77246-442)

Supplier:  AMBEED, INC
Description:   2,5,6-Trichloro-1H-benzo[d]imidazole, Purity: 98%, CAS Number: 16865-11-5, Appearance: White to Yellow Solid, Storage: Inert atmosphere, 2-8 C, Size: 100mg
Supplier:  AMBEED, INC
Description:   4-(Diphenylmethylene)-1,1-dimethylpiperidin-1-ium methyl sulfate, Purity: 98%, CAS Number: 62-97-5, Appearance: Form: Crystal - Powder / Colour: White - Almost white, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 50MG
Supplier:  Strem Chemicals Inc
Description:   CAS #: 157772-65-1. Size: 0.25g.
Catalog Number: (TCC1603-001G)

Supplier:  TCI America
Description:   CAS Number: 42048-11-3
MDL Number: MFCD00019013
Molecular Formula: C7H6ClI
Molecular Weight: 252.48
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 133
Freezing point (°C): 11
Specific Gravity (20/20): 1.86
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  APOLLO SCIENTIFIC
Description:   10-Undecen-1-ol 99%
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   N,N-Dimethylformamide diethyl acetal 95%
Supplier:  Strem Chemicals Inc
Description:   BINAP
Supplier:  AMBEED, INC
Description:   2-Methyl-5-nitrophenylboronic acid, Purity: 97%, CAS Number: 100960-11-0, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 1g
Supplier:  AMBEED, INC
Description:   4,4''-Dibromo-1,1':4',1''-terphenyl, Purity: 97%, CAS Number: 17788-94-2, Appearance: Form: Crystal - Powder / Colour: White - Greyish reddish yellow, Storage: Sealed in dry, Room Temperature, Size: 10g
Supplier:  AMBEED, INC
Description:   (2-Chloro-5-isobutoxyphenyl)boronic acid, Purity: 97%, CAS Number: 1256346-11-8, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 1G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
113 - 128  of 22,352
Prev