Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Ethyl+6-bromo-3-chloro-2-fluorobenzoate


178,925  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"178925"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Biotium
Description:   Disufide crosslinks of cystines in proteins can be reduced to cysteine residues by TCEP (tris-(2-carboxyethyl)phosphine). Unlike DTT (dithiothreitol), TCEP does not contain thiols and therefore usually does not need to be removed prior to thiol modification.

Supplier:  Bioss
Description:   The immunophilins are a highly conserved family of cis-trans peptidyl-prolyl isomerases that bind to and mediate the effects of immunosuppressive drugs, such as cyclosporin, FK506 and rapamycin. Immunophilins have also been implicated in protein folding and trafficking within the endoplasmic reticulum (ER). FKBP11 (FK506-binding protein 11), also known as FKBP19 or peptidyl-prolyl cis-trans isomerase FKBP11, is a 201 amino acid single-pass membrane protein belonging to the FKBP-type PPIase family, a group of proteins known to catalyze the folding of proline-containing polypeptides. Containing one PPIase FKBP-type domain, FKBP11 is expressed in secretory tissues such as pancreas, pituitary, stomach, lymph node and salivary gland, and is encoded by a gene that maps to human chromosome 12q13.12. FK506 and rapamycin are known to inhibit FKBP11’s peptidyl-prolyl isomerase activity.
Supplier:  Spectrum Chemicals
Description:   Dimethylamine Hydrochloride, purity: 98 %, CAS number: 506-59-2, Molecular Formula: C2H7N.HCl, Molecular weight: 81.55, Form: Solid, synonyms: Hydrochloric acid dimethylamine, Methanamine, N-methyl-, hydrochloride, Dimethylammonium chloride, size: 500 g
MSDS SDS
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-Orn-OH · HCl

Supplier:  Bioss
Description:   P2Y purinoceptor 11 (P2Y11) is a 374 amino acid protein belonging to the G-protein coupled receptor one family. P2Y11 is a multi-pass cell membrane protein that acts as a receptor for both ATP and ATD coupled to G proteins. Due to these interactions, P2Y11 is involved in phosphatidylinositol-calcium and adenylyl cyclase pathways. Induced by DMSO and retinoic acid, P2Y11 is highly expressed in spleen tissue. A putative trans-splicing event involving the gene that encodes P2Y11 and an upstream gene encoding PPAN has been found to result in a fusion protein, designated PPAN-P2RY11.
Catalog Number: (103008-568)

Supplier:  Anaspec Inc
Description:   This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
MW: 3433 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   3-Carboxy-1-methylpyridin-1-ium chloride, Purity: 97%, CAS Number: 6138-41-6, Appearance: Form: Crystal - Powder/Colour: White - Almost white, Storage: Inert atmosphere, Room Temperature, Size: 1mg
Supplier:  BeanTown Chemical
Description:   CAS: 52-89-1; EC No: 200-157-7; MDL No: MFCD00064553; RTECS: HA2275000 Solid; Molecular Formula: C3H7NO2S·HCl; MW: 157.62 Optical Rotation: [α]20/D +6.4±0.3°, c = 5% in 5M HCl Hygroscopic
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Vancomycin hydrochloride, 50 mg/mL in distilled water, sterile-filtered.
MSDS SDS
Supplier:  AMBEED, INC
Description:   Boc-D-Arg-OH·HCl·H2O 95%
Supplier:  AMBEED, INC
Description:   H-Glu(OtBu)-OtBu·HCl 98%
Catalog Number: (76839-170)

Supplier:  AMBEED, INC
Description:   H-D-Asp(OMe)-OH·HCl 97%
Supplier:  Bioss
Description:   The immunophilins are a highly conserved family of cis-trans peptidyl-prolyl isomerases that bind to and mediate the effects of immunosuppressive drugs, such as cyclosporin, FK506 and rapamycin. Immunophilins have also been implicated in protein folding and trafficking within the endoplasmic reticulum (ER). FKBP11 (FK506-binding protein 11), also known as FKBP19 or peptidyl-prolyl cis-trans isomerase FKBP11, is a 201 amino acid single-pass membrane protein belonging to the FKBP-type PPIase family, a group of proteins known to catalyze the folding of proline-containing polypeptides. Containing one PPIase FKBP-type domain, FKBP11 is expressed in secretory tissues such as pancreas, pituitary, stomach, lymph node and salivary gland, and is encoded by a gene that maps to human chromosome 12q13.12. FK506 and rapamycin are known to inhibit FKBP11’s peptidyl-prolyl isomerase activity.
Supplier:  Spectrum Chemicals
Description:   L-Tyrosine Methyl Ester Hydrochloride is used as an amino acid synthetic reagent.
Small Business Enterprise

Supplier:  Bioss
Description:   P2Y purinoceptor 11 (P2Y11) is a 374 amino acid protein belonging to the G-protein coupled receptor one family. P2Y11 is a multi-pass cell membrane protein that acts as a receptor for both ATP and ATD coupled to G proteins. Due to these interactions, P2Y11 is involved in phosphatidylinositol-calcium and adenylyl cyclase pathways. Induced by DMSO and retinoic acid, P2Y11 is highly expressed in spleen tissue. A putative trans-splicing event involving the gene that encodes P2Y11 and an upstream gene encoding PPAN has been found to result in a fusion protein, designated PPAN-P2RY11.
Supplier:  BeanTown Chemical
Description:   CAS: 6306-52-1; EC No: 228-620-9; MDL No: MFCD00012497 Crystalline; Molecular Formula: C6H13NO2·HCl; MW: 167.63 Melting Point: 171-173° Optical Rotation: [α]/D +15°, c = 2 in water
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,241 - 8,256  of 178,925