Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4,4'-Diaminostilbene-2,2'-disulfonic+Acid


160,132  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"160132"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (102971-866)

Supplier:  Anaspec Inc
Description:   BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL (Disulfide bridge:23 - 39)
MW:4919.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   5,5'-Dithiobis(2-nitrobenzoic acid) (Ellmans reagent, DTNB) ≥97%
Supplier:  MP Biomedicals
Description:   Bismarck brown Y is a Plasma stain used for staining mucine, cartilage and goblet cells.
MSDS SDS
Supplier:  AMBEED, INC
Description:   2,2-Dimethyl-4,7,10-trioxo-3-oxa-5,8,11-triazatridecan-13-oic acid
Supplier:  AOB CHEM USA
Description:   2-Fluoro-4-formylphenylboronic acid ≥97%
Supplier:  AMBEED, INC
Description:   trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid (CDTA) 98%
New Product
Supplier:  APOLLO SCIENTIFIC
Description:   Isonicotinic acid 99%
Supplier:  Sino Biological
Description:   A DNA sequence encoding the human B4GALT1 extracellular domain (NP_001488.2) (Gly 44-Ser 398) was fused with a polyhistidine tag at the N-terminus.
Supplier:  Thermo Scientific Chemicals
Description:   4-(Boc-aminomethyl)-3-fluorobenzeneboronic acid pinacol ester, 96%
MSDS SDS
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Thermo Scientific Chemicals
Description:   Powder, 22 mesh. Purity based on metal contaminates only.
MSDS SDS
Supplier:  Matrix Scientific
Description:   3-Pyridin-2-ylacrylic acid ≥97%
Supplier:  AMBEED, INC
Description:   1-Boc-4-(Aminomethyl)piperidine, Purity: 97%, CAS Number: 144222-22-0, Appearance: Colorless to pale-yellow liquid or solid, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100g
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 048489-1G , MDL Number: MFCD09265154
Supplier:  BeanTown Chemical
Description:   CAS: 84348-37-8; MDL No: MFCD01860669 Solid; Molecular Formula: C10H15NO5; MW: 229.24 Melting Point: 160° (decomposes) Optical Rotation: [α]22/D +19.0 to +23.0°, c = 0.5 in acetone
MSDS SDS
Supplier:  Matrix Scientific
Description:   1-(4-Methoxybenzyl)piperidine-4-carboxylic acid ≥97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,561 - 2,576  of 160,132