Text Search >
4,4'-Diaminostilbene-2,2'-disulfonic+Acid
Print…
You Searched For:
160,059 results were found
4,4'-Diaminostilbene-2,2'-disulfonic+Acid
Catalog Number:
(RL100-101-189)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Invertase (Candida) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Goat) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL709-103-130)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Human IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL710-1631)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Mouse IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(103007-114)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA MW: 4442.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(RL100-101-208)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Plasminogen (Human Plasma) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Goat) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL100-101-237)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of b -Phosphoglucomutase (Lactococcus lacti) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL204-4307)
Supplier:
Rockland Immunochemical
Description:
Dog IgM mu chain Antibody Peroxidase Conjugated has been assayed against 1.0 µg of Dog IgM in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(101837-808)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 034516-500MG , MDL Number: MFCD01936222
Supplier:
Biotium
Description:
CD6 is a type I transmembrane glycoprotein that contains a 24-amino acid signal sequence, three extracellular scavenger receptor cysteine-rich (SRCR) domains, a membrane-spanning domain and a 44-amino acid cytoplasmic domain. The CD6 glycoprotein is tyrosine phosphorylated during TCR-mediated T cell activation. CD6 shows significant homology to CD5. CD6 is present on mature thymocytes, peripheral T cells and a subset of B cells. Antibodies to CD6 are used to deplete T cells from bone marrow transplants to prevent graft versus host disease.
CF® dyes are Biotium's next-generation fluorescent dyes. CF®405S is a blue fluorescent dye (Ex/Em 404/431 nm) with superior brightness compared to other blue dyes; it is also compatible with super-resolution imaging by SIM. Note: Conjugates of blue fluorescent dyes are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.
Catalog Number:
(RL606-4602)
Supplier:
Rockland Immunochemical
Description:
Anti-Guinea Pig IgG Antibody has been assayed against 1.0 µg of Guinea Pig IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(75928-880)
Supplier:
Rockland Immunochemical
Description:
Interleukin-22 (IL-22) is a cytokine important for the modulation of tissue responses during inflammation (1). Unlike the distantly related IL-10, IL-22 does not inhibit the production of proinflammatory cytokines in monocytes in response to LPS, but it has some inhibitory effects on IL-4 production from Th2 T cells. IL-22 is expressed by both the adaptive arm of the immune system such as CD4 T cell subsets including Th17 cells, as well as by innate lymphocytes such as NK and LTi-like cells (2). IL-22 is highly expressed in several chronic inflammatory conditions, and studies suggest that IL-22 plays both inflammatory and protective roles (3).
Catalog Number:
(RL607-4602)
Supplier:
Rockland Immunochemical
Description:
Anti-Golden Syrian Hamster IgG has been assayed against 1.0 µg of Hamster IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(103360-834)
Supplier:
Novus Biologicals
Description:
The dUTPase Antibody from Novus Biologicals is a rabbit polyclonal antibody to dUTPase. This antibody reacts with human. The dUTPase Antibody has been validated for the following applications: Western Blot.
Catalog Number:
(75789-638)
Supplier:
Prosci
Description:
Nogo-66 Receptor-Related Protein 3 (NgR3) has primary structures with NgR2 (NgRH1, NgRL3) and biochemical properties that are homologous to Nogo-66 receptor (NgR), and constitute a novel neuronal receptor protein family. NgR is GPI-anchored and contains eight leucine-rich repeats (LRR), it is the neuronal receptor for the myelin- associated proteins Nogo-A, OMgp (oligodendrocyte myelin glycoprotein), and MAG (myelin-associated glycoprotein) and mediates the inhibition of CNS axonal regeneration both in vitro and in vivo. NgR2 and NgR3 have similar structure and distinct but overlapping expression versus NgR. NgR2 can be metalloproteinase-cleaved to release a soluble ectodomain. NgR2 has also been shown to bind MAG, but ligands for NgR3 have not yet been determined. Mature huaman NgR3 shares 88%, 88%, 48% and 44% amino acid identity with mature mouse NgR3, rat NgR3, human NgRH1 and NgR, repectively.
Catalog Number:
(10670-236)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF185 (ring finger protein 185), also known as FLJ38628, is a 192 amino acid multi-pass membrane protein containing one RING-type zinc finger. Two RNF185 isoforms exist as a result of alternative splicing, and the gene encoding RNF185 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number:
(RL100-101-228)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of N-Acyl Mannosamine-1-Dehydrogenase (E.coli Recombinant) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
