Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"9416"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Bachem Americas
Description:   PRL2915, Cpa-D-Cys-Pal-D-Trp-Lys-Tle-Cys-Nal-amide, highly potent human somatostatin subtype 2 receptor (hsst2) antagonist with a Ki of 12 nM. Ki values for the other subtypes were >1000 nM for hsst1, 100 ± 57 nM for hsst3, 895 nM for hsst4, and 520 nM for hsst5, respectively. No agonist activity was found when tested alone at concentrations up to 10 µM. In a rat pituitary growth hormone in vitro antagonist assay versus somatostatin-14 (1nM) the somatostatin octapeptide analog PRL2915 exhibited an ICâ‚…â‚€ value of 1.8 nM.
Catalog Number: (77525-818)

Supplier:  AFG BIOSCIENCE LLC
Description:   Rabbit Cystatin C (Cys-C) ELISA Kit
Supplier:  AMBEED, INC
Description:   (R)-Methyl 2-acetamido-3-mercaptopropanoate 97% (by HPLC)
Supplier:  Strem Chemicals Inc
Description:   Phosphine
Supplier:  Matrix Scientific
Description:   MF=C5H12CLNO2S MW=185.67 CAS=868-59-7 MDL=MFCD00012631 100G
Catalog Number: (103006-408)

Supplier:  Anaspec Inc
Description:   (Arg)9 is a cell-permeable peptide used for drug delivery. It can traverse the plasma membrane of eukaryotic cells, and can be easily conjugated to the molecule to be internalized
Sequence:C(Npys)RRRRRRRRR-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Matrix Scientific
Description:   3-(2,6-Dimethylphenyl)cyclohexanone ≥97%
Catalog Number: (103006-410)

Supplier:  Anaspec Inc
Description:   (Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells.
Sequence:C(Npys)rrrrrrrrr-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: (103007-672)

Supplier:  Anaspec Inc
Description:   This is cysteine conjugated to LL-37 via a LC linker. This type of modified LL-37 can be used for KLH, BSA or OVA conjugation.
Sequence: C - LC - [LL-37, 37 aa]
MW: 4709.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Human IFN-alpha 1 Protein, His Tag, ACROBiosystems
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Cysteaminium chloride 98%
Catalog Number: (89367-420)

Supplier:  Genetex
Description:   Peroxiredoxin (Prx) is a growing peroxidase family, whose mammalian members have been known to connect with cell proliferation, differentiation, and apoptosis. Many isoforms (about 50 proteins), collected in accordance to the amino acid sequence homology, particularly amino-terminal region containing active site cysteine residue, and the thiolspecific antioxidant activity, distribute throughout all the kingdoms. Among them, mammalian Prx consists of 6 different members grouped into typical 2-Cys, atypical 2-Cys Prx, and 1-Cys Prx. Except Prx6 belonging to 1-Cys Prx subgroup, the other five 2-Cys Prx isotypes have the thioredoxin-dependent peroxidase (TPx) activity utilizing thioredoxin, thioredoxin reductase, and NADPH as a reducing system. Mammalian Prxs are 20-30 kilodalton in molecular size and vary in subcellular localization: Prx1, 2, and 6 in cytosol, Prx3 in mitochondria, Prx 4 in ER and secretion, Prx 5 showing complicated distribution including peroxisome, mitochondria and cytosol.
Catalog Number: (76704-708)

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Cystatin C(Cys-C) ELISA Kit
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Human IFN-alpha 1 Protein, Fc Tag, ACROBiosystems
Catalog Number: (RL000-001-M48)

Supplier:  Rockland Immunochemical
Description:   HIV tat protein Control Peptide
Supplier:  Biotium
Description:   Revolutionary technology allows antibody labeling with Cyanine 555 (Cy®3) or Cyanine 647 (Cy®5) in 30 minutes without a purification step. The labeling procedure tolerates many common buffer components and antibody stabilizers.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,713 - 3,728  of 9,416