Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"22352"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   MF=C7H9NO2S MW=171.22 CAS=141704-11-2 MDL=MFCD12114489 5G
Supplier:  AMBEED, INC
Description:   4-Cyano-7-azaindole 97%
Supplier:  AOB CHEM USA
Description:   1-(2,3-Dimethylphenyl)cyclobutanol ≥95%
New Product

Supplier:  Genetex
Description:   GTX17251 stains 94% of ovarian carcinomas with a mutation in exon 11. However, staining is absent in 100% of tumors with mutations other than exon 11.

Supplier:  MAPA
Description:   These gloves are designed for applications handling liquid nitrogen and other cryogenic gases, to protect from cold contact and prevent burns from liquid gas leakage.
Catalog Number: (AAAL12862-14)

Supplier:  Thermo Scientific Chemicals
Description:   Bismaleimide Bis(4-maleimidophenyl)methane 1,1'-(Methylenedi-4,1-phenylene)bismaleimide. Grade: 95. Melting Point C156-158*. Boiling Point C: NA. C21H14N2O4. 13676-54-5. TOXIC IRRITANT
MSDS SDS
Catalog Number: (103003-158)

Supplier:  Anaspec Inc
Description:   Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence:YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
MW:5729.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 012564-1G , MDL Number: MFCD06245507
Supplier:  ALADDIN SCIENTIFIC
Description:   2-(4-Chlorophenoxy)aniline ≥97%
New Product
Supplier:  AOB CHEM USA
Description:   (2-Bromo-6-fluoro-4-methylphenyl)methanol ≥97%
New Product
Supplier:  AOB CHEM USA
Description:   Ethyl 7-methyl-α-oxobenzo[b]thiophene-2-acetate ≥95%
New Product
Supplier:  AMBEED, INC
Description:   Methyl octanoate, Purity: 98%, CAS Number: 111-11-5, Appearance: Form: liquid, Colour: colourless, Storage: Sealed in dry, Room Temperature, Size: 100g
Supplier:  Matrix Scientific
Description:   5-(Anilinocarbonyl)-1-methyl-1H-pyrazole-4-carboxylic acid
Supplier:  AMBEED, INC
Description:   4-Ethylphenylacetylene 98%
Supplier:  AOB CHEM USA
Description:   3-Chloro-2,4-dimethylphenylboronic acid ≥97%
Supplier:  AMBEED, INC
Description:   (2R,3S,4R,5R,8R,10R,11R,12S,13S,14R)-11-(((2S,3R,4S,6R)-4-(Dimethylamino)-3-hydroxy-6-methyltetrahydro-2H-pyran-2-yl)oxy)-2-ethyl-3,4,10-trihydroxy-13-(((2R,4R,5S,6S)-5-hydroxy-4-methoxy-4,6-dimethyltetrahydro-2H-pyran-2-yl)oxy)-3,5,8,10,12,14-hexamethyl-1-oxa-6-azacyclopentadecan-15-one ≥97%
New Product
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,417 - 8,432  of 22,352