Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2-(Isopropylamino)-5-pyrimidineboronic+acid+pinacol+ester


8,521  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"8521"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 047327-500MG , MDL Number: MFCD09817453
Catalog Number: (103006-368)

Supplier:  Anaspec Inc
Description:   BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  Lakeland
Description:   High Performance FR Lightweight Pants feature 8 oz. Westex® UltraSoft® fabric that has a unique basketweave blend and provides increased mobility and comfort, making them an excellent choice for arc flash and flash fire protection.
Catalog Number: (101410-992)

Supplier:  Electron Microscopy Sciences
Description:   Crystal Violet solutions are prepared, ready-to-use, high quality staining solutions for standard staining procedures used by the Biological Staining Commission and the Armed Forces Institute of Pathology
Minority or Woman-Owned Business Enterprise
Catalog Number: (101410-998)

Supplier:  Electron Microscopy Sciences
Description:   Crystal Violet solutions are prepared, ready-to-use, high quality staining solutions for standard staining procedures used by the Biological Staining Commission and the Armed Forces Institute of Pathology
Minority or Woman-Owned Business Enterprise
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   6-Bromo-3-methyl-2,3-dihydro-1,3-benzoxazol-2-one 97%

Supplier:  BIOGEMS INTERNATIONAL INC.
Description:   The CD28.2 monoclonal antibody specifically binds with the human 44 kDa homodimeric trans-membrane glycoprotein CD28, expressed on the surface of most mature T lymphocytes, plasma cells, and thymocytes. CD28 is a ligand for B7-1 (CD80) and B7-2 (CD86), a co-stimulator of T lymphocytes, and enhances the interaction between T and B lymphocytes. It has been reported that the T lymphocytes stimulation to produce IL-2 depends on the monoclonal antibody involved, which suggests that the CD28 molecule presents some subregions with distinct functions. The CD28.2 antibody induces Ca2+ influx in Jurkat T lymphocytes. Other studies have shown that CD28 is involved in the signal transduction.
Catalog Number: (100127-830)

Supplier:  Avanti Polar Lipids Inc
Description:   L-α-Phosphatidylcholine (Egg, Chicken-60%) (Total Egg Phosphatide Extract), chloroform
Supplier:  AMBEED, INC
Description:   (R)-2-Fluoro-10a-methyl-5,8,9,10,10a,11-hexahydro-5,6,7a,11-tetraazacyclohepta[def]cyclopenta[a]fluoren-4(7H)-one ≥99%
New Product
Catalog Number: (101836-720)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 033969-500MG , MDL Number: MFCD03419610
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 036928-500MG , MDL Number: MFCD03144060

Supplier:  BIOGEMS INTERNATIONAL INC.
Description:   The CD28.2 monoclonal antibody specifically binds with the human 44 kDa homodimeric trans-membrane glycoprotein CD28, expressed on the surface of most mature T lymphocytes, plasma cells, and thymocytes. CD28 is a ligand for B7-1 (CD80) and B7-2 (CD86), a co-stimulator of T lymphocytes, and enhances the interaction between T and B lymphocytes. It has been reported that the T lymphocytes stimulation to produce IL-2 depends on the monoclonal antibody involved, which suggests that the CD28 molecule presents some subregions with distinct functions. The CD28.2 antibody induces Ca2+ influx in Jurkat T lymphocytes. Other studies have shown that CD28 is involved in the signal transduction.
Supplier:  BIOGEMS INTERNATIONAL INC.
Description:   The CD28.2 monoclonal antibody specifically binds with the human 44 kDa homodimeric trans-membrane glycoprotein CD28, expressed on the surface of most mature T lymphocytes, plasma cells, and thymocytes. CD28 is a ligand for B7-1 (CD80) and B7-2 (CD86), a co-stimulator of T lymphocytes, and enhances the interaction between T and B lymphocytes. It has been reported that the T lymphocytes stimulation to produce IL-2 depends on the monoclonal antibody involved, which suggests that the CD28 molecule presents some subregions with distinct functions. The CD28.2 antibody induces Ca2+ influx in Jurkat T lymphocytes. Other studies have shown that CD28 is involved in the signal transduction.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 029162-500MG , MDL Number: MFCD03422662
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 053481-2.5G , MDL Number: MFCD13562815
Supplier:  AOB CHEM USA
Description:   4-Chloro-3-(trifluoromethyl)phenylboronic acid pinacol ester ≥97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,769 - 6,784  of 8,521