Text Search >
2-Methyl-5-(methylthio)thiophene
Print…
You Searched For:
128,176 results were found
2-Methyl-5-(methylthio)thiophene
Catalog Number:
(10330-068)
Supplier:
Bioss
Description:
This gene encodes the beta C chain of inhibin, a member of the TGF-beta superfamily. This subunit forms heterodimers with beta A and beta B subunits. Inhibins and activins, also members of the TGF-beta superfamily, are hormones with opposing actions and are involved in hypothalamic, pituitary, and gonadal hormone secretion, as well as growth and differentiation of various cell types.
Catalog Number:
(102869-136)
Supplier:
R&D Systems
Description:
The Recombinant Rat beta-NGF (CHO-expressed) Protein from R&D Systems is derived from CHO. The Recombinant Rat beta-NGF (CHO-expressed) Protein has been validated for the following applications: Bioactivity.
Catalog Number:
(102115-362)
Supplier:
Novus Biologicals
Description:
The 14-3-3 beta / alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to 14-3-3 beta / alpha. This antibody reacts with rat. The 14-3-3 beta / alpha Antibody has been validated for the following applications: Western Blot, Immunohistochemistry-Paraffin (Negative).
Catalog Number:
(76173-216)
Supplier:
Boster Biological Technology
Description:
Polyclonal antibody for CEBP BETA/CEBPB detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. CEBP BETA/CEBPB information: Molecular Weight: 36106 MW; Subcellular Localization: Nucleus . Cytoplasm . Translocates to the nucleus when phosphorylated at Ser-288. In T-cells when sumoylated drawn to pericentric heterochromatin thereby allowing proliferation (By similarity); Tissue Specificity: Expressed at low levels in the lung, kidney and spleen.
Catalog Number:
(102130-178)
Supplier:
Novus Biologicals
Description:
The GABA-A R beta 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GABA-A R beta 3. This antibody reacts with human, mouse, rat. The GABA-A R beta 3 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry Free-Floating, Immunofluorescence.
Catalog Number:
(103405-062)
Supplier:
Novus Biologicals
Description:
The beta-III Tubulin Antibody (TU-20) [PE] from Novus Biologicals is a mouse monoclonal antibody to beta-III Tubulin. This antibody reacts with human, mouse, all species. The beta-III Tubulin Antibody (TU-20) [PE] has been validated for the following applications: Flow Cytometry.
Supplier:
Thermo Scientific Chemicals
Description:
250mg CAS: 203854-49-3, MDL: MFCD01863053
Catalog Number:
(103340-018)
Supplier:
Novus Biologicals
Description:
The Beta-1,3-N-Acetylglucosaminyltransferase 1 / B3GNT1 Antibody (2H6) from Novus Biologicals is a mouse monoclonal antibody to Beta-1,3-N-Acetylglucosaminyltransferase 1 / B3GNT1. This antibody reacts with human. The Beta-1,3-N-Acetylglucosaminyltransferase 1 / B3GNT1 Antibody (2H6) has been validated for the following applications: ELISA.
Catalog Number:
(103006-264)
Supplier:
Anaspec Inc
Description:
This peptide is beta-amyloid (1-40) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-40). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Molecular Weight: 4143.7 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(102869-082)
Supplier:
R&D Systems
Description:
The Recombinant Human TGF-beta 1 (Human Cell-expressed) Protein from R&D Systems is derived from HEK293. The Recombinant Human TGF-beta 1 (Human Cell-expressed) Protein has been validated for the following applications: Bioactivity.
Supplier:
ACROBIOSYSTEMS INC MS
Description:
Human Recombinant Latent TGF-beta 1 (from HEK293)
Supplier:
Promega Corporation
Description:
Recombinant full-length human PKC beta II was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. PKC beta II is a member of the protein kinase C (PKC) family of serine- and threonine-specific protein kinases.
Catalog Number:
(103286-478)
Supplier:
Novus Biologicals
Description:
The Lymphotoxin beta / TNFSF3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lymphotoxin beta / TNFSF3. This antibody reacts with human. The Lymphotoxin beta / TNFSF3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number:
(76101-012)
Supplier:
Bioss
Description:
This gene encodes the beta C chain of inhibin, a member of the TGF-beta superfamily. This subunit forms heterodimers with beta A and beta B subunits. Inhibins and activins, also members of the TGF-beta superfamily, are hormones with opposing actions and are involved in hypothalamic, pituitary, and gonadal hormone secretion, as well as growth and differentiation of various cell types.
Catalog Number:
(76085-386)
Supplier:
Bioss
Description:
GNB2 belongs to the WD repeat G protein beta family. Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Catalog Number:
(76172-300)
Supplier:
Boster Biological Technology
Description:
Sandwich High Sensitivity ELISA kit for Quantitative Detection of activated rabbit TGF-beta 2
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
