Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2,3-Bis(amino((2-aminophenyl)thio)methylene)succinonitrile+compou


33,994  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33994"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (77175-512)

Supplier:  ANTIBODIES.COM LLC
Description:   Human HSP90 beta ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i><i>in vitro</i></i> quantitative determination of human HSP90 beta in serum, plasma, and other biological fluids.
Supplier:  Novus Biologicals
Description:   The beta Galactosidase Antibody (DC1 4C7) [DyLight 488] from Novus Biologicals is a mouse monoclonal antibody to beta Galactosidase. This antibody reacts with bacteria. The beta Galactosidase Antibody (DC1 4C7) [DyLight 488] has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence.
Catalog Number: (89318-448)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Casein Kinase 2 beta (casein kinase 2, beta polypeptide)
Catalog Number: (89321-240)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Casein Kinase 2 beta (casein kinase 2, beta polypeptide)
Catalog Number: (89348-620)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to C/EBP beta (CCAAT/enhancer binding protein (C/EBP), beta)

Supplier:  Novus Biologicals
Description:   The IKK beta Antibody (10A9B6) from Novus Biologicals is a mouse monoclonal antibody to IKK beta. This antibody reacts with human, mouse. The IKK beta Antibody (10A9B6) has been validated for the following applications: Western Blot, Simple Western, Flow Cytometry, Immunocytochemistry / Immunofluorescence, Immunoprecipitation, Gel Super Shift Assays, Flow (Intracellular).
Supplier:  Thermo Scientific Chemicals
Description:   A substrate used for the determination of -D-glucosidase
Catalog Number: (76739-098)

Supplier:  ANTIBODIES.COM LLC
Description:   Mouse Fibrinogen beta chain ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse Fibrinogen beta chain in serum, plasma, tissue homogenates, and other biological fluids.
Supplier:  Novus Biologicals
Description:   The IKK beta Antibody (10AG2) [DyLight 488] from Novus Biologicals is a mouse monoclonal antibody to IKK beta. This antibody reacts with human, mouse. The IKK beta Antibody (10AG2) [DyLight 488] has been validated for the following applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  Novus Biologicals
Description:   The IKK beta Antibody (10AG2) [DyLight 680] from Novus Biologicals is a mouse monoclonal antibody to IKK beta. This antibody reacts with human, mouse. The IKK beta Antibody (10AG2) [DyLight 680] has been validated for the following applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (10209-454)

Supplier:  Boster Biological Technology
Description:   Polyclonal antibody for IL 1 BETA/IL1B detection. Host: Rabbit.Size: 100μg/vial. Tested applications: ELISA. Reactive species: Rat. IL 1 BETA/IL1B information: Molecular Weight: 30644 MW; Subcellular Localization: Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.
Supplier:  Shenandoah Biotechnology
Description:   Growth regulated protein beta (GRO-beta), also known as CXCL2, is a chemokine that is secreted by macrophages, neutrophils, and monocytes at sites of inflammation. GRO-beta functions as a chemoattractant for leukocytes and hematopoietic stem cells. GRO-beta activity is mediated through binding the G-protein-coupled chemokine receptor CXCR2.
Supplier:  Anaspec Inc
Description:   This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Bioss
Description:   Plays an important role in the degradation of dermatan and keratan sulfates.
Catalog Number: (103660-916)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Rat IL-1 beta / IL1B (rR IL-1 beta / IL1B; Catalog#80023-RNAE; Q63264-1; Val 117-Ser 268). IL-1 beta / IL1B specific IgG was purified by Rat IL-1 beta / IL1B affinity chromatography.
Supplier:  Genetex
Description:   Mouse Monoclonal antibody [L12-4C-C2] to beta 2 Defensin (a.a. 4-41)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,993 - 5,008  of 33,994
Prev