Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33994"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Novus Biologicals
Description:   The EIF2 beta Antibody (2F3) from Novus Biologicals is a mouse monoclonal antibody to EIF2 beta. This antibody reacts with human, mouse, rat. The EIF2 beta Antibody (2F3) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  Novus Biologicals
Description:   The beta-Arrestin 2 Antibody (3G1) from Novus Biologicals is a mouse monoclonal antibody to beta-Arrestin 2. This antibody reacts with human. The beta-Arrestin 2 Antibody (3G1) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence, Proximity Ligation Assay.
Supplier:  TCI America
Description:   CAS Number: 64017-81-8
MDL Number: MFCD00060747
Molecular Formula: C3H8N2O
Molecular Weight: 124.57
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 153
MSDS SDS

Supplier:  Biotium
Description:   This MAb recognizes TGF beta 1, 2 and 3. Three TGF betas have been identified in mammals. TGF beta 1, TGF beta 2 and TGF beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecules. Biologically active TGF beta requires dimerization of the monomers (usually homodimers) and release of the latent peptide portion. Overall, the mature region of the TGF beta 3 protein has approximately 80% identity to the mature region of both TGF beta 1 and TGF beta 2. However, the NH2 terminals or precursor regions of their molecules share only 27% sequence identity. TGF betas inhibit the growth of epithelial cells and stimulate the growth of mesenchymal cells.

Supplier:  Novus Biologicals
Description:   The Hemoglobin beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hemoglobin beta. This antibody reacts with human. The Hemoglobin beta Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Supplier:  Boster Biological Technology
Description:   Mouse IgG monoclonal antibody for S-100 (beta-subunit), S100 calcium binding protein B (S100B) detection. Tested with WB, IHC-P in Human;mouse;rat. No cross reactivity with other proteins.
Catalog Number: (103636-146)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Human B2M / beta-2 microglobulin (rh B2M / beta-2 microglobulin; Catalog#11976-H08H; NP_004039.1; Met 1-Met 119). Total IgG was purified by Protein A affinity chromatography.

Supplier:  Novus Biologicals
Description:   The GABA-A R beta 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GABA-A R beta 3. This antibody reacts with human, mouse, rat. The GABA-A R beta 3 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry Free-Floating, Immunofluorescence.
Supplier:  Novus Biologicals
Description:   The Beta-1,3-N-Acetylglucosaminyltransferase 1 / B3GNT1 Antibody (2H6) from Novus Biologicals is a mouse monoclonal antibody to Beta-1,3-N-Acetylglucosaminyltransferase 1 / B3GNT1. This antibody reacts with human. The Beta-1,3-N-Acetylglucosaminyltransferase 1 / B3GNT1 Antibody (2H6) has been validated for the following applications: ELISA.
Supplier:  Novus Biologicals
Description:   The beta-III Tubulin Antibody (TU-20) [PE] from Novus Biologicals is a mouse monoclonal antibody to beta-III Tubulin. This antibody reacts with human, mouse, all species. The beta-III Tubulin Antibody (TU-20) [PE] has been validated for the following applications: Flow Cytometry.
Catalog Number: (103006-264)

Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-40) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-40). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4143.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Novus Biologicals
Description:   The 14-3-3 beta / alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to 14-3-3 beta / alpha. This antibody reacts with rat. The 14-3-3 beta / alpha Antibody has been validated for the following applications: Western Blot, Immunohistochemistry-Paraffin (Negative).
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Human Recombinant Integrin alpha V beta 5 (from HEK293)
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Human Recombinant Integrin alpha 8 beta 1 (from HEK293)
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Human Recombinant LAP (TGF-beta 1) (from HEK293)
Supplier:  Invitrogen
Description:   Thermo Scientific Pierce SMPH is an amine-to-sulfhydryl crosslinker that contains NHS-ester and maleimide reactive groups at opposite ends of a long spacer arm (14.2 angstroms).
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,265 - 1,280  of 33,994
Prev   1  2  3  4  5  6  7  8  9  10  11  12  13  14  15  Next