Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Repaglinide

146,568  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
 
SearchResultCount:"146568"
Searching List View List View BETA(new) 
Sort by:
 
 
 
 

Image Unavailable
Description:   L-arginine is an amino acid that is necessary for the production of protein, also helps rid the body of ammonia (a waste product) and stimulates the release of insulin. In addition, L-arginine is used to make nitric oxide (a compound that relaxes the blood vessels).
Catalog Number: IC0210074396
Supplier: MP Biomedicals



Quantity:
 
 
 
   
Image Unavailable
Description:   CAS Number: 6519-67-1
MDL Number: MFCD00067553
Molecular Formula: C13H16N2O2
Molecular Weight: 268.74
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Color: White
Catalog Number: TCT0754-005G
Supplier: TCI America



Quantity:
 
 
 
MSDS SDS    
Image Unavailable
Description:   CAS Number: 57-37-4
MDL Number: MFCD00012624
Molecular Formula: C20H25NO3
Molecular Weight: 363.88
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 178
Catalog Number: TCB0053-5G
Supplier: TCI America



Quantity:
 
 
 
MSDS SDS    
Image Unavailable
Description:   L-Valine methyl ester hydrochloride 97%
Catalog Number: 77276-474
Supplier: AMBEED, INC



Quantity:
 
 
 
   
Image Unavailable
Description:   The immunophilins are a highly conserved family of cis-trans peptidyl-prolyl isomerases that bind to and mediate the effects of immunosuppressive drugs, such as cyclosporin, FK506 and rapamycin. Immunophilins have also been implicated in protein folding and trafficking within the endoplasmic reticulum (ER). FKBP11 (FK506-binding protein 11), also known as FKBP19 or peptidyl-prolyl cis-trans isomerase FKBP11, is a 201 amino acid single-pass membrane protein belonging to the FKBP-type PPIase family, a group of proteins known to catalyze the folding of proline-containing polypeptides. Containing one PPIase FKBP-type domain, FKBP11 is expressed in secretory tissues such as pancreas, pituitary, stomach, lymph node and salivary gland, and is encoded by a gene that maps to human chromosome 12q13.12. FK506 and rapamycin are known to inhibit FKBP11’s peptidyl-prolyl isomerase activity.
Catalog Number: 10293-658
Supplier: Bioss



Quantity:
 
 
 
   
Image Unavailable
Description:   The immunophilins are a highly conserved family of cis-trans peptidyl-prolyl isomerases that bind to and mediate the effects of immunosuppressive drugs, such as cyclosporin, FK506 and rapamycin. Immunophilins have also been implicated in protein folding and trafficking within the endoplasmic reticulum (ER). FKBP11 (FK506-binding protein 11), also known as FKBP19 or peptidyl-prolyl cis-trans isomerase FKBP11, is a 201 amino acid single-pass membrane protein belonging to the FKBP-type PPIase family, a group of proteins known to catalyze the folding of proline-containing polypeptides. Containing one PPIase FKBP-type domain, FKBP11 is expressed in secretory tissues such as pancreas, pituitary, stomach, lymph node and salivary gland, and is encoded by a gene that maps to human chromosome 12q13.12. FK506 and rapamycin are known to inhibit FKBP11’s peptidyl-prolyl isomerase activity.
Catalog Number: 10293-656
Supplier: Bioss



Quantity:
 
 
 
   
Image Unavailable
Description:   Ethyl 7-aminoheptanoate hydrochloride, Purity: 97%, CAS number: 29840-65-1, Appearance: White to off-white powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 10G
Catalog Number: 77306-510
Supplier: AMBEED, INC



Quantity:
 
 
 
   
Image Unavailable
Description:   DL-Tryptophan ethyl ester hydrochloride ≥97%
Catalog Number: 102840-034
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Image Unavailable
Description:   Sequence: H-Glu(OtBu)-OMe · HCl
Catalog Number: E-1885.0001BA
Supplier: Bachem Americas



Quantity:
 
 
 
   
Image Unavailable
Description:   [for Protein modification]
CAS Number: 5873-90-5
MDL Number: MFCD00012575
Molecular Formula: C8H9NO
Molecular Weight: 171.62
Purity/Analysis Method: >98.0% (N,T)
Form: Crystal
Melting point (°C): 107
Storage Temperature: 0-10°C
Catalog Number: TCB0993-001G
Supplier: TCI America



Quantity:
 
 
 
MSDS SDS Certificate Certificates    
Image Unavailable
Description:   DL-Lysine monohydrochloride 95%
Catalog Number: 77109-868
Supplier: AMBEED, INC



Quantity:
 
 
 
   
Product Image
Description:   These ready-made adhesive vinyl labels comply with the updated OSHA HazCom 'secondary container' labeling requirements.
Catalog Number: 103048-630
Supplier: HCL Label



Quantity:
 
 
 
   
Product Image
Description:   TCEP-HCl (Tris(2-carboxyethyl)phosphine hydrochloride) 98%
Catalog Number: TS36383-0010
Supplier: THERMO FISHER SCIENTIFIC CHEMICALS



Quantity:
 
 
 
   
Image Unavailable
Description:   Rabbit Polyclonal antibody to Na-independent D-amino acid transporter Purity: Affinity purified using antigen. Species Reactivity: Human Mouse Rat Tested Applications: IHC IM WB Pkg Size: 100 ug
Catalog Number: 89279-748
Supplier: Genetex



Quantity:
 
 
 
   
Image Unavailable
Description:   This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
MW: 3433 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103008-568
Supplier: Anaspec Inc



Quantity:
 
 
 
   
Image Unavailable
Description:   CAS: 39978-14-8; MDL No: MFCD00068149 Powder; Molecular Formula: C6H7NO2S·HCl; MW: 193.65 Melting Point: 199-200° (decomposes) Hygroscopic
Catalog Number: BT125805-5G
Supplier: BeanTown Chemical



Quantity:
 
 
 
MSDS SDS    
Items Per Page: 16  32  64 
1 - 16  of 146,568
Prev   121  122  123  124  125  126  127  128  129  130  131  132  133  134  135  136  Next