Text Search >
4-[(3-Hydroxybutyl)amino]-3-nitrobenzoic+acid
Print…
You Searched For:
164,640 results were found
4-[(3-Hydroxybutyl)amino]-3-nitrobenzoic+acid
Supplier:
Sino Biological
Description:
A DNA sequence encoding the amino acid sequence (Met 1-Gly 197) of human SHH (Q15465), that is Sonic hedgehog protein N-product, was fused with a polyhistidine tag at the C-terminus.
Catalog Number:
(10319-480)
Supplier:
Bioss
Description:
HGD is a 445 amino acid protein that belongs to the homogentisate dioxygenase family and is involved in the pathway of amino acid degradation. Expressed at high levels in kidney, colon, liver, prostate and small intestine, HGD uses iron as a cofactor to catalyze the oxygen-dependent conversion of homogentisate to 4-maleylacetoacetate, a reaction that is the fourth step in the creation of L-phenylalanine from fumarate and acetoacetic acid. Defects in the gene encoding HGD are the cause of alkaptonuria (AKU), an autosomal recessive disorder that is characterized by urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues and spine arthritis.
Catalog Number:
(10451-480)
Supplier:
Bioss
Description:
Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier.
Catalog Number:
(103632-558)
Supplier:
Sino Biological
Description:
The 77 amino acid endothelial-cell derived form (Ala 23-Ser 99) of the mature human IL8 (NP_000575.1) was expressed and purified.
Catalog Number:
(103633-626)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the rhesus HAVCR1 (BAJ61041.1) (Asp 20-Gly 339) was expressed and purified, with additional two amino acid (Gly and Pro) at the N-terminus.
Catalog Number:
(103623-166)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human DDOST (P39656-1) extracellular domain (Ser 43-Pro 427) was expressed and purified, with additional two amino acids (Gly and Pro) at the N-terminus.
Catalog Number:
(76116-834)
Supplier:
Bioss
Description:
The BTB (Broad-Complex, Tramtrack and Bric a brac) domain, also known as the POZ (Poxvirus and Zinc finger) domain, is an N-terminal homodimerization domain that contains multiple copies of kelch repeats and/or C2H2-type zinc fingers. Proteins that contain BTB domains are thought to be involved in transcriptional regulation via control of chromatin structure and function. ZBTB1 (zinc finger and BTB domain containing 1), also known as KIAA0997, is a 713 amino acid nuclear protein that contains one BTB (POZ) domain and 8 C2H2-type zinc fingers. ZBTB2 is a 514 amino acid nuclear protein that contains one BTB (POZ) domain and 4 C2H2-type zinc fingers. ZBTB25, also known as ZNF46 or KUP, is a 435 amino acid nuclear protein that is expressed mainly in hematopoietic cells and testis and contains one BTB (POZ) domain and 2 C2H2-type zinc fingers.
Supplier:
Anaspec Inc
Description:
PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 MW:4309.8 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
MP Biomedicals
Description:
Ethylenediamine Tetraacetic Acid is a polyamino carboxylic acid hexadentate ligand and a chelating agent.
Catalog Number:
(77555-102)
Supplier:
Sino Biological
Description:
The Chktide peptide sequence (KKKVSRSGLYRSPSMPENLNRPR) is based on the human CDC25C protein isoform A (amino acid 205-225).
Supplier:
Bachem Americas
Description:
Allylglycine-containing peptides may be cleaved selectively at the amide bond between allylglycine and the subsequent amino acid with iodine. The lateral double bond allows selective modifications of a peptide e.g. via metathesis. Replacing cysteine residues by allylglycine allows to obtain carba-analogs of disulfide-bridged peptides.î ‚Educt for obtaining Fmoc-prenylglycine.
Supplier:
TCI America
Description:
N,N-Bis(4-Bromophenyl)-4-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-Yl)Aniline, Purity: >98.0%(HPLC)(T), Cas no: 850153-24-1, Molecular formula : C24H24BBr2NO2, Molecular weight : 529.08, Size: 1G
Catalog Number:
(103011-048)
Supplier:
Anaspec Inc
Description:
DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates. DABCYL, SE is the amino-reactive form of DABCYL, and widely used to prepare a variety of FRET-based probes that contain DABCYL.
Catalog Number:
(101094-900)
Catalog Number:
(10334-152)
Supplier:
Bioss
Description:
Kallikrein 9, also known as Kallikrein-Like 3 (KLK-L3), is a chymotrypsin-like serine proteinase. Kallikrein 9 was discovered as the locus for kallikreins on chromosome 19 was more fully mapped and found by similarity to the other tissue kallikreins. Kallikrein 9 has been found in the ovary, thymus, testis, prostate, skin, breast and neuronal tissues and is made by many cell lines in culture. Kallikrein 9 levels in breast cancer and uterine cancer patients have been reported to drop as the disease progresses, thus hK9 might be considered a favorable prognostic marker. Different splice variants of hK9 have been reported, although it is not yet known if they produce functional proteins. The full length Kallikrein 9 encodes for a 250 amino acid protein, with a predicted mass of 27.5 kDa and a pI of 7.53. The 234 amino acid form predicts a protein of 26 kDa with a pI of 9.76 and this quite basic pI might give the shorter form a very different function or localization. The shorter sequence also diverges before the catalytic serine residue, making it unlikely to be proteolytically active. Pre-pro-kallikrein 9 has the 17 amino acid signal sequence is removed before secretion, and the Pro-kallikrein 9 is activated to Kallikrein 9 by removal of the 5 amino acid propeptide domain.
Supplier:
AMBEED, INC
Description:
H-Thr-OH, Purity: 97%, CAS Number: 72-19-5, Appearance: Form: Crystal - Powder, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1000G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
