Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-[(3-Hydroxybutyl)amino]-3-nitrobenzoic+acid


163,042  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163042"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Sino Biological
Description:   A DNA sequence encoding the human KIAA1279 (Q96EK5) (Met1-Thr621) was expressed with two additional amino acids (Gly and Pro) at the N-terminus.
Supplier:  Sino Biological
Description:   The amino acid sequence corronding to Met 1-Gln 203 of mouse FCGR4 (NP_653142.2) was fused with a polyhistidine tag at the C-terminus.
Supplier:  AMBEED, INC
Description:   N(α)-Cbz-L-tryptophan 97%
Supplier:  Matrix Scientific
Description:   MF=C10H10N2O2 MW=190.20 CAS=57213-48-6 MDL=MFCD01860885 10G
Supplier:  Bachem Americas
Description:   Diphenyldiazomethane was used industrially for producing benzhydryl esters (diphenylmethyl esters) of β-lactam antibiotics. This "polymeric diphenyldiazomethane" readily reacts with carboxylic acids, e.g. Fmoc-amino acids, which need not to be activated. Products can be cleaved from this very acid-sensitive resin derivative with 1-5 % TFA in dichloromethane.
Supplier:  REVACC INC
Description:   A recombinant form of the receptor binding domain (RBD) with amino acids 319 to 541) of the spike (S) glycoprotein gene from SARS-CoV-2 bearing mutations identified in variant of Omicron BA.2, was produced by insect cells, followed by purification.
Supplier:  ALADDIN SCIENTIFIC
Description:   H-D-4-Pal-OH·2HCl ≥98%
New Product
Supplier:  Sino Biological
Description:   A DNA sequence encoding the human SLAMF6 (Q96DU3-1)(Met1-Met226) was expressed with six amino acids (LEVLFQ) at the C-terminus.
Supplier:  Sino Biological
Description:   A DNA sequence encoding the canine CD40 (Q7YRL5) (Met1-Ala194) was expressed with six amino acids (LEVLFQ) at the C-terminus.
Supplier:  Bachem Americas
Description:   Sequence: H-D-allo-Thr-OH
Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4233.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Sino Biological
Description:   A DNA sequence encoding the human CD33 (AAH28152.1) (Met1-His259) was expressed with five amino acids (DDDDK) at the C-terminus.
Supplier:  BECTON DICKINSON DE MEXICO, S. MX
Description:   Inoculum Broth is used for preparing the inoculum of lactobacilli and other microorganisms used in microbiological assays of vitamins and amino acids.
Supplier:  Prosci
Description:   TNF-alpha is a pleiotrophic pro-inflammatory cytokine secreted by various cells including adipocytes, activated monocytes, macrophages, B cells, T cells and fibroblasts. It belongs to the TNF family of ligands and signals through two receptors, TNFR1 and TNFR2. TNF-alpha is cytotoxic to a wide variety of tumor cells and is an essential factor in mediating the immune response against bacterial infections. TNF-alpha also plays a role in the induction of septic shock, auto immune diseases, rheumatoid arthritis, inflammation, and diabetes. Recombinant murine TNF-alpha is a soluble 156 amino acid protein (17.3 kDa) which corresponds to C-terminal extracellular domain of the full length transmembrane protein. Recombinant human TNF-a is a soluble 157 amino acid protein (17.4 kDa) which corresponds to C-terminal extracellular domain of the full length transmembrane protein. Recombinant rat TNFTNF-a is a soluble 157 amino acid protein (17.3 kDa) which corresponds to C-terminal extracellular domain of the full length transmembrane protein.
Supplier:  BeanTown Chemical
Description:   CAS: 3844-45-9; EC No: 223-339-8; MDL No: MFCD00001657; RTECS: BQ4725000 Powder; Molecular Formula: C37H34Na2N2O9S3; MW: 792.85 Melting Point: 283° (decomposes)
MSDS SDS
Supplier:  Bioss
Description:   HGD is a 445 amino acid protein that belongs to the homogentisate dioxygenase family and is involved in the pathway of amino acid degradation. Expressed at high levels in kidney, colon, liver, prostate and small intestine, HGD uses iron as a cofactor to catalyze the oxygen-dependent conversion of homogentisate to 4-maleylacetoacetate, a reaction that is the fourth step in the creation of L-phenylalanine from fumarate and acetoacetic acid. Defects in the gene encoding HGD are the cause of alkaptonuria (AKU), an autosomal recessive disorder that is characterized by urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues and spine arthritis.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,537 - 7,552  of 163,042