4-[(3-Hydroxybutyl)amino]-3-nitrobenzoic+acid
Supplier:
Promega Corporation
Description:
Recombinant human FGFR1 (amino acids 399-822) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. FGFR1 (also known as FLT2) is a member of the Fibroblast Growth Factor Receptor family.
Supplier:
TCI America
Description:
N,N-Bis(4-Bromophenyl)-4-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-Yl)Aniline, Purity: >98.0%(HPLC)(T), Cas no: 850153-24-1, Molecular formula : C24H24BBr2NO2, Molecular weight : 529.08, Size: 1G
Supplier:
Anaspec Inc
Description:
PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 MW:4309.8 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(101094-900)
Supplier:
Enzo Life Sciences
Description:
Produced in <i>E. coli.</i> Contains 154 amino acids.
Supplier:
AMBEED, INC
Description:
H-Thr-OH, Purity: 97%, CAS Number: 72-19-5, Appearance: Form: Crystal - Powder, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1000G
Catalog Number:
(103005-892)
Supplier:
Anaspec Inc
Description:
This is a negative control peptide containing the reversed sequence of the first two amino acids of the receptor-activating (tethered ligand) peptide SFLLRN-NH2. It shows no detectable affinity for the binding sites.
Sequence:FSLLRN-NH2 MW:747.9 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Catalog Number:
(10451-480)
Supplier:
Bioss
Description:
Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier.
Catalog Number:
(10319-478)
Supplier:
Bioss
Description:
HGD is a 445 amino acid protein that belongs to the homogentisate dioxygenase family and is involved in the pathway of amino acid degradation. Expressed at high levels in kidney, colon, liver, prostate and small intestine, HGD uses iron as a cofactor to catalyze the oxygen-dependent conversion of homogentisate to 4-maleylacetoacetate, a reaction that is the fourth step in the creation of L-phenylalanine from fumarate and acetoacetic acid. Defects in the gene encoding HGD are the cause of alkaptonuria (AKU), an autosomal recessive disorder that is characterized by urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues and spine arthritis.
Catalog Number:
(103681-214)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the amino acids (Met 1-Thr 765) of human SEMA5A (NP_003957.2) extracellular domain was fused with Fc region of human IgG1 at the C-terminus.
Catalog Number:
(103632-898)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the Influenza A virus (A/Anhui/1/2013(H7N9)) Neuraminidase (translated amino acids of EPI439509) (His36-Leu465) was expressed , the cell lysates are collected, and bio-activity was tested.
Catalog Number:
(103008-180)
Supplier:
Anaspec Inc
Description:
This peptide is derived from Histone H3 21-44 amino acids, and is usually used as a substrate for methylation assays. It has been used as a substrate for protein arginine methyltransferases
Sequence:ATKAARKSAPATGGVKKPHRYRPG MW:2505.9 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
AMBEED, INC
Description:
Fmoc-(S)-3-Cyclopentylalanine 97%
Supplier:
Promega Corporation
Description:
Recombinant human MET (amino acids 956-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. MET is a proto-oncogene that encodes a transmembrane growth factor receptor.
Catalog Number:
(77402-782)
Supplier:
APOLLO SCIENTIFIC
Description:
4-(Methylsulfonylamino)benzeneboronic acid 95%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||