Text Search >
4-[(PYrazin-2-ylcarbonyl)amino]butanoic+acid
Print…
You Searched For:
165,202 results were found
4-[(PYrazin-2-ylcarbonyl)amino]butanoic+acid
Catalog Number:
(76195-944)
Supplier:
Prosci
Description:
This mAb reacts with a protein of ~13kDa, identified as alpha subunit of Luteinizing Hormone (LH) or Chorionic Gonadotrophin (CG). The protein dimer contains 2 polypeptide units, labeled alpha and beta subunits that are connected by two bridges. The alpha subunits of LH, FSH, TSH, and hCG are identical, and contain 92 amino acids. The beta subunits vary. LH has a beta subunit of 121 amino acids (LHB) that confers its specific biologic action and is responsible for interaction with the LH receptor. This beta subunit contains the same amino acids in sequence as the beta subunit of hCG and both stimulate the same receptor; however, the hCG beta subunit contains an additional 24 amino acids and the hormones differ in the composition of their sugar moieties. LH is synthesized and secreted by gonadotrophs in the anterior lobe of the pituitary gland. In concert with the other pituitary gonadotropin follicle-stimulating hormone (FSH), it is necessary for proper reproductive function. In the female, an acute rise of LH levels triggers ovulation. In the male, where LH has also been called Interstitial Cell-Stimulating Hormone (ICSH), it stimulates Leydig cell production of testosterone. LH is a useful marker in classification of pituitary tumors and the study of pituitary disease.
Catalog Number:
(77671-252)
Supplier:
AMBEED, INC
Description:
3-Fur-2-yl-D-alanine ≥97%
Supplier:
Bachem Americas
Description:
Sequence: Boc-Arg(Pbf)-OH
Catalog Number:
(103005-892)
Supplier:
Anaspec Inc
Description:
This is a negative control peptide containing the reversed sequence of the first two amino acids of the receptor-activating (tethered ligand) peptide SFLLRN-NH2. It shows no detectable affinity for the binding sites.
Sequence:FSLLRN-NH2 MW:747.9 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Supplier:
AMBEED, INC
Description:
Methyl-4-aminocyclohexanecarboxylate hydrochloride (cis and trans mixture) 97%, Ambeed.Inc
Supplier:
AMBEED, INC
Description:
Fmoc-(S)-3-Cyclopentylalanine 97%
Supplier:
PeproTech, Inc.
Description:
The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are expressed in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF1 is essential for normal differentiation of the antral and pyloric gastric mucosa, and functions as a gastric-specific tumor suppressor gene. Recombinant Human TFF-1 is a 6.7 kDa monomeric protein consisting of a 60 amino acid polypeptide chain, which includes a 40-amino acid trefoil motif containing three conserved intramolecular disulfide bonds.
Catalog Number:
(89358-474)
Supplier:
Genetex
Description:
N-myristoyltransferase (NMT) catalyzes the reaction of N-terminal myristoylation of many signaling proteins. It transfers myristic acid from myristoyl coenzyme A to the amino group of a protein's N-terminal glycine residue. Biochemical evidence indicates the presence of several distinct NMTs, varying in apparent molecular weight and /or subcellular distribution. The predicted 498-amino acid of human NMT2 protein shares 77% and 96% sequence identity with human NMT1 and mouse Nmt2 comprise two distinct families of N-myristoyltransferases. [provided by RefSeq]
Catalog Number:
(80056-726)
Supplier:
MilliporeSigma
Description:
(L-5-HTP). Off-white solid. PROTECT FROM LIGHT. Serotonin precursor. Purity: >= 95% by HPLC. Soluble in acidic solutions and H2O. RTECS YN7110000, CAS 4350-09-8, M.W. 220.2. WARNING! Harmful. LD50 of <= 2000 mg/kg.
Catalog Number:
(103622-112)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human HSP90 isoform 2 (NP_005339.3) C-terminal segment, corresponding to amino acid sequence (Glu 535-Asp 732) was expressed and purified, with two additonal aa (Gly and Pro) at the N terminus.
Catalog Number:
(103007-358)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2 Molecular Weight: 3616 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(76204-108)
Supplier:
MP Biomedicals
Description:
Ethylenediaminetetraacetic Acid Trisodium Salt Hydrate White Crystalline Powder
Catalog Number:
(10298-260)
Supplier:
Bioss
Description:
GLYCTK is a 523 amino acid protein that is expressed as seven isoforms which are present throughout the body. Localized to the cytoplasm and the mitochondrion in an isoform-specific manner, GLYCTK functions to catalyze the ATP-dependent conversion of (R)-glycerate to 3-(R)-glycerate, thereby playing an important role in neural and skeletal muscle systems. Defects in the gene encoding GLYCTK are the cause of D-glyceric acidemia, an inborn error of amino acid metabolism that is best described as nonketotic hyperglycinemia and is characterized by the excretion of D-glyceric acid in the urine.
Catalog Number:
(10298-276)
Supplier:
Bioss
Description:
GLYCTK is a 523 amino acid protein that is expressed as seven isoforms which are present throughout the body. Localized to the cytoplasm and the mitochondrion in an isoform-specific manner, GLYCTK functions to catalyze the ATP-dependent conversion of (R)-glycerate to 3-(R)-glycerate, thereby playing an important role in neural and skeletal muscle systems. Defects in the gene encoding GLYCTK are the cause of D-glyceric acidemia, an inborn error of amino acid metabolism that is best described as nonketotic hyperglycinemia and is characterized by the excretion of D-glyceric acid in the urine.
Supplier:
Biotium
Description:
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
