Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"64654"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Anaspec Inc
Description:   GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  TCI America
Description:   CAS Number: 102410-65-1
MDL Number: MFCD00155632
Molecular Formula: C23H19NO4
Molecular Weight: 373.41
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 176
Specific rotation [a]20/D: 81 deg (C=1, DMF)
MSDS SDS
Supplier:  Bachem Americas
Supplier:  AMBEED, INC
Description:   (9H-Fluoren-9-yl)methyl (3-aminopropyl)carbamate hydrochloride 95%
Supplier:  TCI America
Description:   CAS Number: 119062-05-4
MDL Number: MFCD00237654
Molecular Formula: C19H17NO6
Molecular Weight: 355.35
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: -30 deg (C=1, DMF)
MSDS SDS
Supplier:  AMBEED, INC
Description:   (S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-6-phenylhexanoic acid ≥95%
New Product
Supplier:  TCI America
Description:   Sodium 1-[(9H-Fluoren-9-ylmethoxy)carbonylamino]cyclopropanecarboxylate, Purity: >98.0%(HPLC), MF: C19H16NNaO4, MW: 345.33, Synonym: 1-[(9H-Fluoren-9-ylmethoxy)carbonylamino]cyclopropanecarboxylic Acid Sodium Salt, Size: 1G
Supplier:  TCI America
Description:   CAS Number: 71989-18-9
MDL Number: MFCD00037135
Molecular Formula: C24H27NO6
Molecular Weight: 425.48
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 90
Specific rotation [a]20/D: -8 deg (C=1, MeOH)
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 71989-14-5
MDL Number: MFCD00037131
Molecular Formula: C23H25NO6
Molecular Weight: 411.45
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 150
Specific rotation [a]20/D: -25 deg (C=1, DMF)
MSDS SDS
Supplier:  AMBEED, INC
Description:   (2S,3R)-Benzyl 2-(((9H-fluoren-9-yl)methoxy)carbonyl)amino)-3-hydroxybutanoate 95%
Supplier:  AMBEED, INC
Description:   (S)-5-Carbamoyl-3-(9H-fluoren-9-ylmethoxycarbonyl-amino)-pentanoic acid ≥97%
New Product
Supplier:  AMBEED, INC
Description:   N-(((9H-Fluoren-9-yl)methoxy)carbonyl)-S-((2,4,6-trimethoxyphenyl)thio)-L-cysteine ≥97%
New Product
Supplier:  AMBEED, INC
Description:   (9H-Fluoren-9-yl)methyl hydrazinecarboxylate 98%
New Product
Supplier:  Anaspec Inc
Description:   This human Angiotensin I (Ang I) sequence also corresponds to horse, sheep, pig, and rat Ang I. Ang I is cleaved to Ang II by the angiotensin-converting enzyme (ACE). There is also evidence for non-angiotensin-converting enzyme-dependent conversion of Ang I to Ang II. Human chymase efficiently converts the 10-mer Ang I to the 8-mer hormone Ang II by splitting the Phe8-His9 bond in Ang I.
Sequence: DRVYIHPFHL
MW: 1296.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   for Research Use Only
Supplier:  TCI America
Description:   CAS Number: 95753-55-2
MDL Number: MFCD00057810
Molecular Formula: C24H20N2O6
Molecular Weight: 432.43
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: -40 deg (C=1, DMF)
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,449 - 2,464  of 64,654