Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(S)-2-Amino-3-methoxypropanoic+acid


119,008  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"119008"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Bioss
Description:   ILVBL is a 632 amino acid single-pass membrane protein that belongs to the TPP enzyme family. Expressed in the majority of tissues, ILVBL has the highest level of expression in heart, pancreas and placenta. ILVBL is highly homologous to several bacterial enzymes, including the B isozyme of the large catalytic subunit of E. coli acetohydroxy-acid synthase (AHAS) and the oxalyl-coA decarboxylase of O. formigenes, that utilize thiamine pyrophosphate as a cofactor. ILVBL binds one magnesium ion and one thiamine pyrophosphate per subunit, and may catalyze the initial step in branched-chain amino acid biosynthesis. The gene encoding ILVBL maps to human chromosome 19p13.12 and mouse chromosome 10 C1.
Catalog Number: (103009-746)

Supplier:  Anaspec Inc
Description:   TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier:  Bioss
Description:   DBX2 is a 339 amino acid member of the H2.0 homeobox family. DBX2, which is localized to the nucleus, contains one homeobox DNA-binding domain, a region of 60 amino acids that binds DNA through a helix-turn-helix type of structure. DBX2, which is expressed in the forebrain, midbrain, hindbrain and spinal cord, has been implicated in CNS development.Specifically, DBX2 has been shown to play a role in spinal cord dorsal/ventral patterning, as well as the regionalization of the CNS. DBX2 is also thought to play a role in the production of multiple spinal cord cell types.

Supplier:  Prosci
Description:   At least 23 different variants of Interferon- alpha are known. The individual proteins have molecular masses between 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- alpha subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- alpha subtypes differ in their sequences at only one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.
Catalog Number: (76011-570)

Supplier:  Prosci
Description:   RBPMS2 contains one RRM (RNA recognition motif) domain. The exact function of RBPMS2 remains unknown.
Supplier:  Bioss
Description:   Ubr7 is a 425 amino acid protein that contains one UBR-type zinc finger and one PHD zinc finger. Participating in protein modification events within the N-end rule pathway, Ubr7 functions as an E3 ubiquitin-protein ligase that recognizes and binds proteins that contain destabilizing N-terminal residues, thereby leading to their ubiquitination and subsequent degradation.
Supplier:  Bioss
Description:   Ubr7 is a 425 amino acid protein that contains one UBR-type zinc finger and one PHD zinc finger. Participating in protein modification events within the N-end rule pathway, Ubr7 functions as an E3 ubiquitin-protein ligase that recognizes and binds proteins that contain destabilizing N-terminal residues, thereby leading to their ubiquitination and subsequent degradation.
Catalog Number: (10426-684)

Supplier:  Bioss
Description:   The protein encoded by ANP32C is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns.
Supplier:  MP Biomedicals
Description:   L-Arginine is one of the three amino acids with basic side chains, and is very hydrophilic in character. It contains a guanidino group in the side chain, and this moiety is protonated at physiological pH.
MSDS SDS
Supplier:  TCI America
Description:   5-Ethynyl-2'-deoxycytidine, Purity: >98.0%(N), CAS Number: 69075-47-4, Molecular Formula: C11H13N3O4, Synonym: EdC, Form: Crystal-Powder, Solid, Color: White - Slightly pale reddish yellow, Size: 200MG
MSDS SDS
Catalog Number: (10748-998)

Supplier:  Prosci
Description:   ADP ribosylation factors (Arfs) are small GTP-binding proteins known for their role in vesicular transport, where they nucleate the assembly of coat protein complexes at sites of carrier vesicle formation. IQSEC1 (GEP100/BRAG2), a guanine nucleotide exchange protein for ARF6, belongs to the BRAG family and contains one IQ domain, one PH domain and one SEC7 domain. As a known activator of ARF6, IQSEC1 regulates cell surface levels of Beta1 integrin and its knockdown blocked tumour metastasis. IQSEC1 links EGFR signaling to ARF6 activation and may contribute to the cancer metastasis and malignancy.
Supplier:  AAT BIOQUEST INC
Description:   EDANS is one of the most popular donors for developing FRET-based nucleic acid probes (such as Molecular Beacons) and protease substrates.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Anaspec Inc
Description:   This is a fluorescent (FITC)-labeled Erythropoietin (EPO)-mimetic peptide (EMP17), Abs/Em=494/520 nm. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: FITC-LC-TYSCHFGPLTWVCKPQGG
MW: 2483.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: (103008-150)

Supplier:  Anaspec Inc
Description:   EMP17 is an erythropoietin (EPO)-mimetic peptide. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: TYSCHFGPLTWVCKPQGG
MW: 1981.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Bioss
Description:   The protein encoded by ANP32C is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns.

Supplier:  Genetex
Description:   C-Peptide is part of the molecule of Proinsulin, that consists of three parts: C-Peptide and two long strands of amino acids (called the alpha and beta chains) that later become linked together to form the insulin molecule. From every molecule of proinsulin, one molecule of insulin plus one molecule of C-Peptide are produced C-peptide is released into the bloodstream in equal amounts to insulin. A test of C-peptide levels will show how much insulin the body is making.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,441 - 1,456  of 119,008