Text Search >
5-(3-Isopropoxyphenyl)thiazol-2-amine
Print…
You Searched For:
125,210 results were found
5-(3-Isopropoxyphenyl)thiazol-2-amine
Catalog Number:
(102998-454)
Supplier:
Anaspec Inc
Description:
A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7) MW: 3431.9 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(10281-546)
Supplier:
Bioss
Description:
Prickle1 is an 831 amino acid protein that contains one PET domain and three LIM zinc-binding domains and localizes to the cytoplasm, as well as to the nuclear membrane. Expressed at higher levels in placenta and at lower levels in liver, brain, kidney, lung and pancreas, Prickle1 is thought to function as a nuclear receptor that interacts with NRSF, a silencer protein that binds the DNA sequence element NRSE (neuron-restrictive silencer element). Defects in the gene encoding Prickle1 are associated with autosomal recessive progressive myoclonic epilepsy-1B, which is characterized by quick jerks of the arms, shoulders or legs. The gene encoding Prickle1 maps to human chromosome 12, which encodes over 1,100 genes and comprises approximately 4.5% of the human genome.
Catalog Number:
(10275-972)
Supplier:
Bioss
Description:
DPPA5 is a 116 amino acid protein that localizes to the cytoplasm and contains one KH domain. Expressed in embryonic germ (EG), primordial germ (PG) and embryonic stem (ES) cells, DPPA5 plays an important role in the maintenance of ES cell pluripotency and may be necessary for proper embryogenesis. The gene encoding DPPA5 maps to human chromosome 6, which contains 170 million base pairs and comprises nearly 6% of the human genome. Deletion of a portion of the q arm of chromosome 6 is associated with early onset intestinal cancer, suggesting the presence of a cancer susceptibility locus. Additionally, Porphyria cutanea tarda, Parkinson's disease, Stickler syndrome and a susceptibility to bipolar disorder are all associated with genes that map to chromosome 6.
Catalog Number:
(10275-956)
Supplier:
Bioss
Description:
DPPA5 is a 116 amino acid protein that localizes to the cytoplasm and contains one KH domain. Expressed in embryonic germ (EG), primordial germ (PG) and embryonic stem (ES) cells, DPPA5 plays an important role in the maintenance of ES cell pluripotency and may be necessary for proper embryogenesis. The gene encoding DPPA5 maps to human chromosome 6, which contains 170 million base pairs and comprises nearly 6% of the human genome. Deletion of a portion of the q arm of chromosome 6 is associated with early onset intestinal cancer, suggesting the presence of a cancer susceptibility locus. Additionally, Porphyria cutanea tarda, Parkinson's disease, Stickler syndrome and a susceptibility to bipolar disorder are all associated with genes that map to chromosome 6.
Catalog Number:
(10281-550)
Supplier:
Bioss
Description:
Prickle1 is an 831 amino acid protein that contains one PET domain and three LIM zinc-binding domains and localizes to the cytoplasm, as well as to the nuclear membrane. Expressed at higher levels in placenta and at lower levels in liver, brain, kidney, lung and pancreas, Prickle1 is thought to function as a nuclear receptor that interacts with NRSF, a silencer protein that binds the DNA sequence element NRSE (neuron-restrictive silencer element). Defects in the gene encoding Prickle1 are associated with autosomal recessive progressive myoclonic epilepsy-1B, which is characterized by quick jerks of the arms, shoulders or legs. The gene encoding Prickle1 maps to human chromosome 12, which encodes over 1,100 genes and comprises approximately 4.5% of the human genome.
Catalog Number:
(10278-322)
Supplier:
Bioss
Description:
SCUBE3 is a novel secreted 993 amino acid cell-surface osteoblast protein that plays an important role in bone cell biology. While highly expressed in osteoblasts, SCUBE3 expression is unobservable or very low in non-bone tissues. SCUBE3 forms homo-oligomers and hetero-oligomers with SCUBE1, and may undergo C-terminal proteolytic cleavage or become N-glycosylated following translation. Two SCUBE3 isoforms exist as a result of alternative splicing events. SCUBE3 contains one CUB domain and nine EGF-like domains, and is encoded by a gene which maps to human chromosome 6p21.31, a region associated with a rare form of metabolic bone disease known as Paget's disease. Chromosome 6 contains 170 million base pairs and comprises nearly 6% of the human genome.
Catalog Number:
(10253-892)
Supplier:
Bioss
Description:
The regulated translation of messenger RNA is essential for cell-cycle progression, establishment of the body plan during early development and modulation of key activities in the central nervous system. Cytoplasmic polyadenylation, one mechanism of controlling translation, is driven by cytoplasmic polyadenylation element binding proteins, called CPEBs. CPEB3 (cytoplasmic polyadenylation element binding protein 3) is a 698 amino acid protein that contains two RNA recognition motif (RRM) domains and, like other CPEB proteins, may play a role in the maturation of the central nervous system. CPEB3 exists as multiple alternatively spliced isoforms that are encoded by a gene which maps to human chromosome 10, which houses over 1,200 genes and comprises nearly 4.5% of the human genome.
Catalog Number:
(10255-968)
Supplier:
Bioss
Description:
Advillin is an 819 amino acid protein that localizes to both the cytoplasm and the cytoskeleton and contains one HP domain and six gelsolin-like repeats. Expressed at high levels in colon and small intestine and at lower levels in uterus, thymus, testis and prostate, advillin functions as a calcium-regulated Actin-binding protein that may be involved in the development of neuronal cells, specifically those that form ganglia. The gene encoding advillin maps to human chromosome 12, which encodes over 1,100 genes and comprises approximately 4.5% of the human genome. Chromosome 12 is associated with a variety of diseases and afflictions, including hypochondrogenesis, achondrogenesis, Kniest dysplasia, Noonan syndrome and Trisomy 12p, which causes facial developmental defects and seizure disorders.
Catalog Number:
(10262-788)
Supplier:
Bioss
Description:
The Hox homeobox genes encode proteins that are transcriptional regulators with an established role in embryonic development. HoxC5 is a 222 amino acid protein that localizes to the nucleus and contains one homeobox DNA-binding domain. Existing as multiple alternatively spliced isoforms, HoxC5 functions as a sequence-specific DNA-binding transcription factor that is part of a regulatory mechanism that provides cells with positional identities during development. The gene encoding HoxC5 maps to a cluster of Hox proteins on chromosome 12 that are essential for morphogenesis. Encoding over 1,100 genes within 132 million bases, chromosome 12 makes up about 4.5% of the human genome. A number of skeletal deformities are linked to chromosome 12, including hypochondrogenesis, achondrogenesis and Kniest dysplasia.
Catalog Number:
(10245-606)
Supplier:
Bioss
Description:
Staphylococcal enterotoxins represent a group of proteins, which are secreted by Staphylococcus aureus and cause staphylococcal food poisoning syndrome. The illness is characterised by high fever, hypotension, diarrhea, shock, and in some cases death. Their molecular masses range between 27 and 30 kDa. At present, seven enterotoxins are known, namely A, B, C1, C2, C3, D and E. Their amino acid sequences have been determined and it was shown that all are single chain polypeptides containing one disulfide bond formed by two half cystines located in the middle of the polypeptide chain, which form the so called cysteine loop. SEB is an extremely potent activator of T cells, stimulating the production and secretion of various cytokines which mediate many of the toxic effects of SEB.
Catalog Number:
(10250-124)
Supplier:
Bioss
Description:
Protocadherins are a large family of cadherin-like cell adhesion proteins that are involved in the establishment and maintenance of neuronal connections in the brain. There are three protocadherin gene clusters designated alpha, beta and gamma, all of which contain multiple tandemly arranged genes. The protocadherein gamma cluster consists of three subfamilies (A, B and C). As a member of the gamma subfamily B, PCDHGB1 (Protocadherin gamma B1) is a 927 amino acid protein that is one of 22 proteins encoded by the protocadherin gamma cluster. Typical of gamma protocadherins, PCDHGB1 contains six cadherin motifs and is a type I transmembrane receptor expressed in the central nervous system. With localization to synapses, members of the gamma cluster of protocadherins are essential for neuronal survival. There are two isoforms of PCDHGB1 that are produced as a result of alternative splicing events.
Catalog Number:
(10250-000)
Supplier:
Bioss
Description:
Protocadherins are a large family of cadherin-like cell adhesion proteins that are involved in the establishment and maintenance of neuronal connections in the brain. There are three protocadherin (PCDH) gene clusters, designated alpha, beta and gamma, all of which contain multiple tandemly arranged genes. PCDHGA9 (Protocadherin gamma-A9) is a 932 amino acid that is one of 22 proteins encoded by the protocadherin gamma cluster. The protocadherein gamma cluster consists of three subfamilies (A, B and C) and PCDHGA9 is a member of the gamma subfamily A. PCDHGA9 is a type I transmembrane receptor containing six cadherin motifs and is expressed in the central nervous system where it localizes to synapses. Members of the gamma cluster of protocadherins are essential for neuronal survival. There are two isoforms of PCDHGA9 that are produced as a result of alternative splicing events.
Catalog Number:
(10263-210)
Supplier:
Bioss
Description:
Biotin, also known as vitamin B7, is an essential water-soluble vitamin that is a cofactor in glucogenesis and in the metabolism of fatty acids and leucine. Biotinidase is a 523 amino acid enzyme that catalyzes the hydrolysis of biocytin to biotin and lysine. Secreted into extracellular space, biotinidase is expressed in liver, heart, placenta, brain, skeletal muscle, pancreas and kidney. Biotinidase contains one carbon-nitrogen hydrolase domain, which is involved in the reduction of organic nitrogen compounds and ammonia production. Defects in the gene encoding biotinidase are the cause of biotinidase deficiency, which is characterized by skin rash, ataxia, seizures, hearing loss, hypotonia and optic atrophy. These symptoms are due to the individual’s inability to reutilize biotin and can, therefore, typically be treated with the addition of free biotin.
Catalog Number:
(10267-634)
Supplier:
Bioss
Description:
NPDC-1 (Neural Proliferation Differentiation and Control-1) is expressed in neurons once they have stopped dividing and begun to differentiate. NPDC-1 is transported from the Golgi apparatus via vesicles before becoming internalized by endosomes at the cell membrane. NPDC-1 interacts with Cdk2, D-type cyclins, and the transcription factor E2F1. This interaction can lead to an increased replication time, and might have implications in final neural differentiation and apoptosis. NPDC-1 has been shown to colocalize with synaptic vesicle proteins: synaptophysin, synaptobrevin 2, and Rab3 GEP (Rab3 GTP/GDP exchange protein). One function of NPDC-1 is to regulate retinoic acid-mediated events by directly interacting with retinoid receptors. The amino acid sequence of NPDC-1 is highly conserved between mouse, rat, and human.
Catalog Number:
(10283-308)
Supplier:
Bioss
Description:
Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. The majority of zinc-finger proteins contain a Krüppel-type DNA binding domain and a KRAB domain, which is thought to interact with KAP1, thereby recruiting histone modifying proteins. Zinc finger protein 568 (ZNF568) is a 644 amino acid member of the Krüppel C2H2-type zinc-finger protein family. Localized to the nucleus, ZNF568 contains fifteen C2H2-type zinc fingers and one KRAB domain through which it is thought to be involved in DNA-binding and transcriptional regulation. Two isoforms of ZNF568 exist as a result of alternative splicing events.
Catalog Number:
(10207-056)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 4(KCNA4) detection. Tested with WB in Human;Mouse;Rat.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
