4-Amino-3-bromobenzoic+acid
Supplier:
BeanTown Chemical
Description:
CAS: 150-25-4; EC No: 205-755-1; MDL No: MFCD00004295; RTECS: MB9700000
Powder; Molecular Formula: C6H13NO4; MW: 163.17
Catalog Number:
(10072-610)
Supplier:
Prosci
Description:
BMPs (Bone Morphogenetic Proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis and is expressed in a variety of tissues including lung, spleen, brain, liver, prostate ovary and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant human BMP-2 is a 26.0 kDa homodimeric protein consisting of two 115 amino acid polypeptide chains.
Catalog Number:
(103008-568)
Supplier:
Anaspec Inc
Description:
This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG MW: 3433 Da % Peak area by HPLC: 95 Storage condition: -20°C
Supplier:
Thermo Scientific Chemicals
Description:
MDL: MFCD00064225
Beilstein Registry No.: 1910407
Catalog Number:
(77098-034)
Supplier:
AMBEED, INC
Description:
N-Benzyloxycarbonyl-L-glutamic acid-1-tert-butyl ester dicyclohexylammonium salt 97%
Supplier:
PeproTech, Inc.
Description:
IL-17E is a disulfide-linked homodimer of two 145 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region, but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17E stimulates secretion of IL-8, and induces activation of the transcription factor NF-κB in cells that express the IL-17BR receptor. Recombinant Human IL-17E is a 33.8 kDa disulfide-linked homodimer of two 146 amino acid polypeptide chains.
Supplier:
Thermo Scientific Chemicals
Description:
Amido Black 10B, Electrophoresis Reagent.
Catalog Number:
(75790-154)
Supplier:
Prosci
Description:
Calumenin is a secreted calcium-binding protein that belongs to the CREC family. Calumenin contains six EF-hand domains and is expressed at high levels in the heart, placenta and skeletal muscle. Human Calumenin is synthesized as a 315 amino acid precursor that contains a 19 amino acid signal sequence, and a 296 amino acid mature chain. Calumenin localizes to the endoplasmic reticulum (ER) and sarcoplasmic reticulum (SR) of mammalian tissues which plays a role in ER functions as protein folding and sorting. Calumenin is involved in the regulation of vitamin K-dependent carboxylation of multiple N-terminal glutamate residues. It seems to inhibit gamma -carboxylase GGCX.
Catalog Number:
(F-2520.0001BA)
Supplier:
Bachem Americas
Description:
Sequence: H-p-Chloro-D-Phe-OH
Catalog Number:
(100277-262)
Supplier:
Indofine Chemical Company
Description:
Rare Organics & BioChemicals 1gm BOC-D-Bta-OH 321.4 Room temperature.
![]() ![]()
Catalog Number:
(101798-038)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 010183-500MG , MDL Number: MFCD06799734
Catalog Number:
(77977-144)
Supplier:
LGC STANDARDS
Description:
2-Amino-N-(2-chloro-6-methylphenyl)-5-thiazolecarboxamide, TRC, LGC Standards
Catalog Number:
(89142-924)
Supplier:
Enzo Life Sciences
Description:
Glutamate receptor ligand.
Supplier:
Adipogen
Description:
Potent inhibitor of ethylene synthesis in plants acting at the level of 1-aminocyclopropanecarboxylic acid synthase.
Supplier:
Enzo Life Sciences
Description:
Produced in <i>E. coli.</i> A monomer containing 175 amino acids.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||