4-Amino-3-bromobenzoic+acid
Supplier:
PeproTech, Inc.
Description:
CT-1 is a member of the IL-6 family of cytokines which also includes LIF, CNTF, OSM (Oncostatin M), IL-11, IL-6 and possibly NNT-1/BSF-3. CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung and signals through the LIF receptor and the gp130 receptor subunit. CT-1 has the ability to induce cardiac myocyte hypertrophy, and enhances the survival of cardiomyocyte and different neuronal populations. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Murine Cardiotrophin-1 is a 21.3 kDa protein consisting of 202 amino acid residues.
Supplier:
AMBEED, INC
Description:
H-Glu-otbu 95% (contains < 9% H₂O)
Catalog Number:
(100271-268)
Supplier:
Indofine Chemical Company
Description:
Rare Organics & BioChemicals 1155-64-2 25gm 280.3 Room temperature.
![]() ![]()
Supplier:
AAT BIOQUEST INC
Description:
Calcium measurement is critical for numerous biological investigations.
![]() ![]()
Supplier:
LIFE TECHNOLOGIES CORP
Description:
Soy 100 is a highly digested soy protein peptone that is high in nucleosides and free amino acid content. It has high concentrations of vitamins and carbohydrates, which is recommended for the cultivation of a wide variety of microbial organisms as well as varied mammalian cell culture applications.
Supplier:
AOB CHEM USA
Description:
3-(Methylsulfonylamino)phenylboronic acid ≥95%
Catalog Number:
(76303-716)
Supplier:
PeproTech, Inc.
Description:
Myostatin is a TGF-beta family member that acts as an inhibitor of skeletal muscle growth. This muscle-specific cytokine interacts with Activin type I and type II receptors, and suppresses myoblast proliferation by arresting cell-cycle in the G1 phase. Suppression of myostatin activity facilitates muscle formation, and may be useful in reducing and/or preventing adiposity and type-2 diabetes. Myostatin activity can be blocked by the activin-binding protein follistatin, and by the propeptide of myostatin. Recombinant Human/Murine/Rat Myostatin is a 25.0 kDa protein consisting of two identical 109 amino acid polypeptides linked by a single disulfide bond. The amino acid sequence of mature myostatin is extremely conserved across species, and is the same in murine, rat, chicken, turkey, porcine, and human. Myostatin is expressed as the C-terminal part of a precursor polypeptide, which also contains a short N-terminal signal sequence for secretion, and a propeptide of 243 amino acids. After dimerization of this precursor, the covalent bonds between the propeptide and the mature ligand are cleaved by furin-type proteases. However, the resulting two proteins remain associated through non-covalent interactions, and are secreted as a latent complex.
Catalog Number:
(100295-270)
Supplier:
Indofine Chemical Company
Description:
Rare Organics & BioChemicals 3262-72-4 25gm BOC-Ser-OH 205.2 Room temperature.
![]() ![]()
Supplier:
BeanTown Chemical
Description:
CAS: 312-84-5; EC No: 206-229-4; MDL No: MFCD00004269; RTECS: VT8200000
Crystalline; Molecular Formula: C3H7NO3; MW: 105.09
Supplier:
Bachem Americas
Description:
Diphenyldiazomethane was used industrially for producing benzhydryl esters (diphenylmethyl esters) of β-lactam antibiotics. This "polymeric diphenyldiazomethane" readily reacts with carboxylic acids, e.g. Fmoc-amino acids, which need not to be activated. Products can be cleaved from this very acid-sensitive resin derivative with 1-5 % TFA in dichloromethane.
Supplier:
TCI America
Description:
CAS Number: 6994-25-8
MDL Number: MFCD00005238 Molecular Formula: C6H9N3O2 Molecular Weight: 155.16 Purity/Analysis Method: >98.0% (GC,T) Form: Crystal Melting point (°C): 102
Catalog Number:
(103009-742)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ MW:3248.51 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(10100-920)
Supplier:
Prosci
Description:
ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
Supplier:
Bachem Americas
Description:
Sequence: Fmoc-D-Glu(OtBu)-OH · H₂O
CAS-No.: 104091-08-9
Mol.weight: 443.50
SumFormula: C₂₄H₂₇NO₆ · H₂O
Bulk item no.: B-1320
Synonym(s):
EINECS no.: -
MDL no.: MFCD00797526
Supplier:
PeproTech, Inc.
Description:
RELMα belongs to a unique family of tissue-specific cytokines termed FIZZ (found in inflammatory zone) and RELM. The four known members of this family, resistin, RELMα, RELMβ, and RELMγ, are 85-94 amino acid, secreted proteins sharing a conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X11-C-X8-C-X-C-X3-C-X10-C-X-C-X-C-X9-C-C. RELMα and resistin are secreted exclusively by adipocytes, while RELMβ is expressed in the epithelium of the colon and small bowel. The physiological role and molecular targets of RELMα are still unknown. Recombinant Murine RELMα is a 10.0 kDa monomeric protein containing 89 amino acid residues.
Supplier:
PeproTech, Inc.
Description:
IL-17E is a disulfide-linked homodimer of two 145 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region, but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17E stimulates secretion of IL-8, and induces activation of the transcription factor NF-κB in cells that express the IL-17BR receptor. Recombinant Human IL-17E is a 33.8 kDa disulfide-linked homodimer of two 146 amino acid polypeptide chains.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||