Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-Amino-3-bromobenzoic+acid


161,852  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"161852"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   3-Aminopicolinamide, Purity: 98%, CAS Number: 50608-99-6, Appearance: White to Pale-yellow to Yellow-brown Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1g
Supplier:  ALADDIN SCIENTIFIC
Description:   Heterobifunctional PEG derivative that can be used to modify proteins, peptides and other materials via amino or other acid reactive chemical groups. PEGylation can increase solubility and stability and reduce immunogenicity of peptides and proteins. It can also suppress the non-specific binding of charged molecules to the modified surfaces.
New Product
Supplier:  Thermo Scientific Chemicals
Description:   5KG
MSDS SDS
Catalog Number: (103009-746)

Supplier:  Anaspec Inc
Description:   TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  MP Biomedicals
Description:   Tris has been useful as buffers in a wide variety of biological systems. Uses include pH control in vitro and in vivo for body fluids and in buffering systems for electrophoresis applications. Tris has been used as a starting material for polymers, oxazolones (with carboxylic acids) and oxazolidines (with aldehydes). Tris does not precipitate calcium salts and is of value in maintaining solubility of manganese salts. It can be used for the direct standardization of a strong acid solution; the equivalence point can be determined either potentiometrically or by use of a suitable indicator such as 3-(4-Dimethylamino-1-naphthylazo)-4-methoxybenzenesulfonic acid. It is an auxiliary material in pharmaceutical science.
Store at Room Temperature (15-30 °C). Store dessicated.
Supplier:  Bachem Americas
Description:   Sequence: H-Tyr(Me)-OH
Catalog Number: (10450-490)

Supplier:  Bioss
Description:   Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids.
Supplier:  Thermo Scientific Chemicals
Description:   D-Propargylglycine, Purity: 97%, CAS No. 23235-03-2, Formula: C5H7NO2, Color: White, Form: Powder, Synonyms: D-Pra-OH and
(R)-2-Amino-4-pentynoic acid, size: 5g.
MSDS SDS
Supplier:  PeproTech, Inc.
Description:   SDF-1α and β are stromal-derived, CXC chemokines that signal through the CXCR4 receptor. SDF-1α and β chemoattract B and T cells, and have been shown to induce migration of CD34+ stem cells. Additionally, the SDF-1 proteins exert HIV-suppressive activity in cells expressing the CXCR4 receptor. Human and murine SDF-1 proteins act across species. SDF-1α and β contain the four highly conserved cysteine residues present in CXC chemokines. The mature SDF-1α protein is the result of alternative splicing of the SDF-1 gene and contains 68 amino acid residues. Recombinant Murine SDF-1α (CXCL12) is a 7.9 kDa protein containing 68 amino acid residues.
Supplier:  ALADDIN SCIENTIFIC
Description:   3-Aminopyrrolidine dihydrochloride (3-pyrrolidinamine dihydrochloride) is one of the key intermediate of tosufloxacin and other quinolone antibiotics.3-Aminopyrrolidine dihydrochloride is the suitable reagent used as an internal standard for the quantitative analysis of amino acids in bio-fluids. (R,S) 3-Aminopyrrolidine dihydrochloride may be used in the preparation of cis-[PdCl2(pyrr)] and cis-[PtCl2(pyrr)] (pyrr= (R,S)-3-aminopyrrolidine) complexes.
New Product
Catalog Number: (E-2010.0250BA)

Supplier:  Bachem Americas
Description:   Sequence: H-His-OH
Supplier:  Bachem Americas
Description:   Sequence: H-Asn(Trt)-OH

Supplier:  Bioss
Description:   Amisyn is a mostly cytosolic protein related to Tomosyn which plays an important role in SNARE complex assembly. Amisyn contains a v-SNARE coiled coil homology domain that binds to Syntaxin 1A and weakly to Syntaxin 4. Three isoforms exist for Amisyn. Isoform 1 is the full length protein, isoform 2 has a different amino acid sequence between residues 204-210 and isoform 3 is missing amino acids 1-102 and contains a different sequence for amino acids 103-150. Amisyn lacks a transmembrane domain and therefore is unable to assemble into a functional, membrane-anchored SNARE complex. This suggests that Amisyn may instead be acting to maintain SNARE conformation and facilitate the binding of VAMP-2. Amisyn can inhibit exocytosis independent of Syntaxin binding.
Supplier:  AMBEED, INC
Description:   Fmoc-Thi-OH 95%
Supplier:  AMBEED, INC
Description:   Methyl 3-(2-(4-(adamantan-1-yl)phenoxy)acetamido)-4-hydroxybenzoate, Purity: 97%, CAS Number: 934593-90-5, Appearance: Form: Crystal - Powder/Colour: White - Pale reddish yellow, Storage: Inert atmosphere, 2-8 C, Size: 50mg
Supplier:  Sino Biological
Description:   A DNA sequence encoding the amino acids (Met 1-Ala 189) of mouse KITL (P20826-1) was fused with a polyhistidine tag at the C-terminus.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,361 - 7,376  of 161,852