Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-Amino-3-bromobenzoic+acid


163,518  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163518"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103008-442)

Supplier:  Anaspec Inc
Description:   This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: (A-4550.0005BA)

Supplier:  Bachem Americas
Description:   Sequence: Boc-Trp(Boc)-OH
Supplier:  AMBEED, INC
Description:   Methyl-4-aminocyclohexanecarboxylate hydrochloride (cis and trans mixture) 97%, Ambeed.Inc
New Product
Catalog Number: (76069-948)

Supplier:  Prosci
Description:   GPR120 Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Isotype: Ig, Immunogen: KLH conjugated synthetic peptide between231-260 amino acids from the Central region of human GPR120, Synonyms: Free fatty acid r
Supplier:  Matrix Scientific
Description:   MF=C11H20Cl2N4O MW=295.21 ,500Mg
Catalog Number: (10112-622)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: FBXL12 antibody was raised against a 12 amino acid synthetic peptide near the C-Terminus of FBXL12,Application: ELISA
Catalog Number: (10116-570)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Immunogen: RANBP9 antibody was raised against a 13 amino acid synthetic peptide near the C-Terminus of RANBP9; Application: ELISA
Catalog Number: (10112-146)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: XAGE1 antibody was raised against a 13 amino acid synthetic peptide near the C-Terminus of XAGE1, Application: ELISA
Supplier:  Spectrum Chemicals
Description:   L-Tyrosine - Ungraded products supplied by Spectrum are indicative of a grade suitable for general industrial use or research purposes and typically are not suitable for human consumption or therapeutic use.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   D-Glutamic acid 5-tert-butyl ester, 95%
MSDS SDS
Catalog Number: (103008-426)

Supplier:  Anaspec Inc
Description:   This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-g). B8R binding to IFN-g neutralizes its antiviral activity.
Sequence:TSYKFESV
MW:960.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Thermo Fisher Scientific Chemicals Inc.
Description:   1 kg
Catalog Number: (10100-010)

Supplier:  Prosci
Description:   GPT and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.GPT (MIM 138200) and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.
Supplier:  Thermo Scientific Chemicals
Description:   1g CAS: 104504-45-2, MDL: MFCD00238102
MSDS SDS
Supplier:  AMBEED, INC
Description:   Boc-N-methyl-D-alanine 98%
Supplier:  AMBEED, INC
Description:   Fmoc-D-Phg-OH 98%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,905 - 7,920  of 163,518