Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Proteins and Peptides


10,355  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"10355"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   2,5-Dioxopyrrolidin-1-yl 2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetate, Purity: 97%, CAS Number: 55750-61-3, Appearance: Form: Crystal - Powder, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 5G
Supplier:  Bachem Americas
Description:   H-6578 corresponds to the selective bradykinin B₂ receptor agonist labradimil.
Supplier:  Bachem Americas
Description:   The dipeptide serylhistidine was found to cleave DNA and proteins as BSA at pH 5-6.
Catalog Number: (H-1316.0500BA)

Supplier:  Bachem Americas
Description:   See also the pTH2 receptor agonist TIP39 (H-4878).
Supplier:  Bachem Americas
Description:   LHRH is also called Gonadotropin-Releasing Hormone (GnRH) or Luteinizing Hormone-Releasing Factor (LRF).
Catalog Number: (G-2375.0001BA)

Supplier:  Bachem Americas
Description:   The dipeptide IR showed a remarkable ACE- and renin-inhibitory activity.
Supplier:  LGC STANDARDS
Description:   2-(2-(4-(Dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl)ethoxy)ethyl AcetateQuetiapine Acetate, TRC, LGC Standards
New Product
Supplier:  GE Healthcare - Whatman
Description:   Mixed cellulose ester, WME range, circles, gridded. Whatman mixed cellulose ester membranes are composed of cellulose acetate and cellulose nitrate. These membranes are characterized by a smoother and more uniform surface than pure nitrocellulose filters.
Product available on GSA Advantage®
Supplier:  AMBEED, INC
Description:   (R)-2-(4'-(3-Methyl-4-(((1-phenylethoxy)carbonyl)amino)isoxazol-5-yl)-[1,1'-biphenyl]-4-yl)acetic acid, Purity: 98%, CAS Number: 1228690-36-5, Appearance: white to off white to beige powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 10mg
Supplier:  Restek
Description:   Free Acid Form: DCAA (2,4-dichlorophenyl acetic acid). 200ug/mL in methanol, 1mL/ampule.
Catalog Number: (G-2700.0001BA)

Supplier:  Bachem Americas
Description:   Both single-dose administration and repetitive oral application of the dipeptide KY significantly decreased blood pressure in spontaneously hypertensive rats.
Catalog Number: (H-9200.0005BA)

Supplier:  Bachem Americas
Description:   LHRH is also called Gonadotropin-Releasing Hormone (GnRH) or Luteinizing Hormone-Releasing Factor (LRF).
Catalog Number: (H-9020.0500BA)

Supplier:  Bachem Americas
Description:   Endothelins are peptides with exceptional vasoconstrictor potency. They play an important role in intercellular communications.
Supplier:  Bachem Americas
Description:   CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.
Supplier:  Bachem Americas
Description:   LHRH is also called Gonadotropin-Releasing Hormone (GnRH) or Luteinizing Hormone-Releasing Factor (LRF).
Supplier:  TCI America
Description:   Ethyl 3-Oxo-3-(4-Pyridyl)Propionate, Purity: >98.0%(GC)(T), Cas no: 26377-17-3, MF: C10H11NO3, MW: 193.20, Synonyms: Ethyl (Isonicotinoyl)acetate, (Isonicotinoyl)acetic Acid Ethyl Ester, 3-Oxo-3-(4-pyridyl)propionic Acid Ethyl Ester, Size: 1G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,697 - 7,712  of 10,355