Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

4-(4-Methylpiperazin-1-ylmethyl)benzoic+acid


8,512  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"8512"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 030584-500MG , MDL Number: MFCD03943463
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 048489-1G , MDL Number: MFCD09265154

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 008396-500MG , MDL Number: MFCD02197522
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 036988-500MG , MDL Number: MFCD12027027
Supplier:  Bioss
Description:   FTSJ1 is a 329 amino acid nucleolar protein belonging to the RlmE family and methyltransferase superfamily. Expressed in adult thalamus, hippocampus, amygdala, corpus callosum and caudate nucleus, as well as fetal kidney, lung, liver, brain and lung, FTSJ1 plays a role in rRNA modification and processing. FTSJ1 exists as multiple spliced isoforms which are encoded by a gene located on human chromosome Xp11.23. Notably, defects in the gene encoding FTSJ1 are the cause of mental retardation X-linked type 44 (MRX44) and nonsyndromic X-linked mental retardation (MRX9).
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 043556-1G , MDL Number: MFCD02571875
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 048038-500MG , MDL Number: MFCD10758103
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00011750 Beilstein Registry No.: 4077708
MSDS SDS
Supplier:  BIOGEMS INTERNATIONAL INC.
Description:   The CD28.2 monoclonal antibody specifically binds with the human 44 kDa homodimeric trans-membrane glycoprotein CD28, expressed on the surface of most mature T lymphocytes, plasma cells, and thymocytes. CD28 is a ligand for B7-1 (CD80) and B7-2 (CD86), a co-stimulator of T lymphocytes, and enhances the interaction between T and B lymphocytes. It has been reported that the T lymphocytes stimulation to produce IL-2 depends on the monoclonal antibody involved, which suggests that the CD28 molecule presents some subregions with distinct functions. The CD28.2 antibody induces Ca2+ influx in Jurkat T lymphocytes. Other studies have shown that CD28 is involved in the signal transduction.
Catalog Number: (103006-368)

Supplier:  Anaspec Inc
Description:   BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   3-Bromo-1-propylboronic acid pinacol ester 97%

Supplier:  Bioss
Description:   p44/42 MAP Kinase(Thr202); ERK (extracellular signal regulated kinase), also known as MAPK (mitogen activated protein kinase) has two closely related isoforms of 44 kDa and 42 kDa, respectively. These kinases belong to a family of serine/threonine kinases that are activated upon treatment of cells with a large variety of stimuli including mitogens, hormones, growth factors, cytokines, and bioactive peptides. Cell stimulation induces the activation of a signaling cascade, the downstream effects of which have been linked to the regulation of cell growth and differentiation as well as the cytoskeleton. ERK1 and ERK2 are phosphorylated within the activation loop on both a Threonine and a Tyrosine residue (within a Thr-Glu-Tyr motif) by MEKs (MAPK/ERK kinases), thereby greatly elevating the activity of ERK1&2.
Supplier:  Sino Biological
Description:   A DNA sequence encoding the human B3GNT6 (NP_619651.3)(Gln44-Ser384) was fused with a polyhistide tag at the N-terminus.
Supplier:  Bioss
Description:   p44/42 MAP Kinase(Thr202); ERK (extracellular signal regulated kinase), also known as MAPK (mitogen activated protein kinase) has two closely related isoforms of 44 kDa and 42 kDa, respectively. These kinases belong to a family of serine/threonine kinases that are activated upon treatment of cells with a large variety of stimuli including mitogens, hormones, growth factors, cytokines, and bioactive peptides. Cell stimulation induces the activation of a signaling cascade, the downstream effects of which have been linked to the regulation of cell growth and differentiation as well as the cytoskeleton. ERK1 and ERK2 are phosphorylated within the activation loop on both a Threonine and a Tyrosine residue (within a Thr-Glu-Tyr motif) by MEKs (MAPK/ERK kinases), thereby greatly elevating the activity of ERK1&2.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 029131-500MG , MDL Number: MFCD03422619
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 025899-500MG , MDL Number: MFCD09997495
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,049 - 8,064  of 8,512