Lithium+chloride
Supplier:
Enzo Life Sciences
Description:
Produced in <i>E. coli.</i> Contains 252 amino acids.
Supplier:
Sino Biological
Description:
A DNA sequence encoding the amino acid (Met 1-Ala 189) of human SCF (P21583-1) extracellular domain was expressed, with a polyhistidine tag at the C-terminus.
Supplier:
Bachem Americas
Description:
Sequence: Z-Ser(tBu)-OH
Supplier:
Enzo Life Sciences
Description:
Produced in <i>E. coli.</i> Contains 179 amino acids.
Supplier:
Spectrum Chemicals
Description:
L-Glutamine, FCC - The FCC grade meets the requirements of the Food Chemical Codex indicates and is suitable for all food, beverage and nutritional supplement applications. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
![]()
Supplier:
PeproTech, Inc.
Description:
The IGFs are mitogenic, polypeptide growth factors that stimulate the proliferation and survival of various cell types, including muscle, bone, and cartilage tissue in vitro . IGFs are predominantly produced by the liver, although a variety of tissues produce the IGFs at distinctive times. The IGFs belong to the Insulin gene family, which also contains insulin and relaxin. The IGFs are similar to insulin by structure and function, but have a much higher growth-promoting activity than insulin. IGF-II expression is influenced by placenta lactogen, while IGF-I expression is regulated by growth hormone. Both IGF-I and IGF-II signal through the tyrosine kinase type I receptor (IGF-IR), but IGF-II can also signal through the IGF-II/Mannose-6-phosphate receptor. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contain N-terminal and C-terminal propeptide regions. Recombinant Human IGF-I and IGF-II are globular proteins containing 70 and 67 amino acids, respectively, and 3 intra-molecular disulfide bonds. IGF-I LR3 is a recombinant analog of human IGF-I comprised of the complete IGF-I sequence, with an Arginine substitution for the third position Glutamic acid, and a 13 amino acid length N terminus peptide extension. Specifically engineered for higher biological potency Recombinant Human IGF-I LR3 is a 9.1 kDa, single, non-glycosylated polypeptide chain containing 83 amino acid residues.
Catalog Number:
(103007-358)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2 Molecular Weight: 3616 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10286-478)
Supplier:
Bioss
Description:
ACAA1 is a 424 amino acid member of the thiolase family of enzymes and is involved in lipid metabolism. Localized to the peroxisome, ACAA1 catalyzes the conversion of acyl-CoA and acetyl-CoA to 3-oxoacyl-CoA in the fatty acid oxidation pathway. ACAA1 shows high enzymatic activity in liver, kidney, intestine and white adipose tissue in rats, where it exists as two types, namely type A and type B. Human ACAA1 shares 86% amino acid identity with its rat counterpart, suggesting a conserved function for ACAA1 among different species.
Catalog Number:
(10286-470)
Supplier:
Bioss
Description:
ACAA1 is a 424 amino acid member of the thiolase family of enzymes and is involved in lipid metabolism. Localized to the peroxisome, ACAA1 catalyzes the conversion of acyl-CoA and acetyl-CoA to 3-oxoacyl-CoA in the fatty acid oxidation pathway. ACAA1 shows high enzymatic activity in liver, kidney, intestine and white adipose tissue in rats, where it exists as two types, namely type A and type B. Human ACAA1 shares 86% amino acid identity with its rat counterpart, suggesting a conserved function for ACAA1 among different species.
Catalog Number:
(10451-974)
Supplier:
Bioss
Description:
Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier.
Catalog Number:
(10080-812)
Supplier:
Prosci
Description:
Polyclonal, Host: Rabbit, Species reacivity: human, Immunogen: Synthetic 16 amino acid peptide from human , Tested application: IHC
Supplier:
PeproTech, Inc.
Description:
IL-8 is a proinflammatory CXC chemokine that can signal through the CXCR1 and CXCR2 receptors. It is secreted by monocytes and endothelial cells. IL-8 chemoattracts and activates neutrophils. Recombinant Human IL-8 (CXCL8) (monocyte-derived) is an 8.4 kDa protein containing 72 amino acid residues.
Catalog Number:
(103005-972)
Supplier:
Anaspec Inc
Description:
A 18-amino acid peptide from bee venom, a selective blocker of calcium activated potassium channels.
Sequence:CNCKAPETALCARRCQQH-NH2 (Disulfide bridge: 1-11; 3-15) MW:2027.4 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(102512-000)
Supplier:
Adipogen
Description:
Human CD10 is a well known marker for common acute lymphoblastic leukemia antigen (CALLA). CD10 is expressed on normal early B cells in bone marrow and is also on fetal thymocytes. CD10 expression is lost as the T and B lineage cells mature and only appears again on activated germinal center B cells. CD10 is present on neutrophils. CD10 is a neutral endopeptidase and hydrolyzes peptide bonds on the amino side of hydrophobic amino acids.
![]()
Catalog Number:
(102511-998)
Supplier:
Adipogen
Description:
Human CD10 is a well known marker for common acute lymphoblastic leukemia antigen (CALLA). CD10 is expressed on normal early B cells in bone marrow and is also on fetal thymocytes. CD10 expression is lost as the T and B lineage cells mature and only appears again on activated germinal center B cells. CD10 is present on neutrophils. CD10 is a neutral endopeptidase and hydrolyzes peptide bonds on the amino side of hydrophobic amino acids.
![]()
Catalog Number:
(103008-040)
Supplier:
Anaspec Inc
Description:
This peptide is Histone H3 amino acid residues 31 to 41 tri-methylated at Lys-36.
Sequence:STGGV-K(Me3)-KPHRY MW:1271.4 Da % peak area by HPLC:95 Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||