Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
 
SearchResultCount:"23968"
Searching List View List View BETA(new) 
Sort by:
 
 
 
 

Image Unavailable
Description:   2-(2,6-Difluorophenyl)-3,5-dioxo-2,3,4,5-tetrahydro-1,2,4-triazine-6-carbonitrile
Catalog Number: 77418-412
Supplier: APOLLO SCIENTIFIC



Quantity:
 
 
 
   
Image Unavailable
Description:   This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-366
Supplier: Anaspec Inc



Quantity:
 
 
 
   
Image Unavailable
Description:   3, 5-Dihydroxytoluene, CAS number 504-15-4, Chemical Formula: C7H8O2, Synonyms: 5-Methylresorcinol, Orcinol, for synthesis, 2g
Catalog Number: EM8.20933.0002
Supplier: MilliporeSigma



Quantity:
 
 
 
Certificate Certificates    
Product Image
Description:   Matrix Scientific Part Number: 041002-500MG , MDL Number: MFCD00454154
Catalog Number: 101850-590
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Product Image
Description:   Matrix Scientific Part Number: 016275-500MG , MDL Number: MFCD06800625
Catalog Number: 101804-426
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Product Image
Description:   Matrix Scientific Part Number: 037747-500MG , MDL Number: MFCD01076649
Catalog Number: 101844-100
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Product Image
Description:   Matrix Scientific Part Number: 036579-500MG , MDL Number: MFCD00462195
Catalog Number: 101841-664
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Product Image
Description:   Matrix Scientific Part Number: 036781-500MG , MDL Number: MFCD09937736
Catalog Number: 101842-070
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Image Unavailable
Description:   1-(3,5-Difluorophenyl)-2,2,2-trifluoroethanone, Purity: 97%, CAS number: 845823-12-3, Appearance: Solid or liquid, Storage: Sealed in dry, 2-8C, Size: 10G
Catalog Number: 76987-092
Supplier: AMBEED, INC



Quantity:
 
 
 
   
Image Unavailable
Description:   MF=C9H7NO2 MW=161.16 CAS=1129-35-7 MDL=MFCD00001823 100G
Catalog Number: 102540-050
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Image Unavailable
Description:   3-Fluoro-2-nitropyridine, Purity: 98%, CAS number: 54231-35-5, Appearance: Form: Crystal - Powder, Storage: Inert atmosphere, 2-8C, Size: 250MG
Catalog Number: 76975-636
Supplier: AMBEED, INC



Quantity:
 
 
 
   
Image Unavailable
Description:   MF=C12H18N2 MW=190.29 CAS=60407-35-4 MDL=MFCD04038444 10G
Catalog Number: 102531-010
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Product Image
Description:   MF=C4H4Brnos MW=194.06 Cas=240816-35-7 MDL=MFCD07787374 1G
Catalog Number: 101940-340
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Image Unavailable
Description:   (1E,6E)-1,7-Bis(3,4-dimethoxyphenyl)hepta-1,6-diene-3,5-dione, Purity: 98%, CAS Number: 160096-59-3, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 10mg
Catalog Number: 77262-610
Supplier: AMBEED, INC



Quantity:
 
 
 
   
Product Image
Description:   Matrix Scientific Part Number: 063643-500MG , MDL Number: MFCD06797875
Catalog Number: 101926-116
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Product Image
Description:   Matrix Scientific Part Number: 050285-500MG , MDL Number: MFCD13560686
Catalog Number: 101891-042
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Items Per Page: 16  32  64 
1 - 16  of 23,968
Prev   141  142  143  144  145  146  147  148  149  150  151  152  153  154  155  156  Next