Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Cyclopropyl(2,3-dichloropyridin-4-yl)methanone


15,892  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"15892"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   MF=C12H16O MW=176.26 Cas=100058-36-4 5G
Supplier:  Matrix Scientific
Description:   MF=C11H10O3 MW=190.20 Cas=1081559-36-5 1G
Supplier:  Thermo Scientific Chemicals
Description:   3, 6-Dihydro-2H-pyran-4-boronic acid pinacol ester, Purity: 98%, CAS Number: 287944-16-5, Molecular Formula: C11H19BO3, Color: White, Form: Solid, 1G
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C6H12BR2 MW=243.98 CAS=629-03-8 MDL=MFCD00000272 100G
Supplier:  TCI America
Description:   CAS Number: 525-05-3
MDL Number: MFCD00003885
Molecular Formula: C10H7NO8S2
Molecular Weight: 377.25
Purity/Analysis Method: >98.0% (T)
Form: Crystal
MSDS SDS
Supplier:  AMBEED, INC
Description:   3,6-Diphenylpyrrolo[3,4-c]pyrrole-1,4(2H,5H)-dione, Purity: 98%, CAS Number: 54660-00-3, Appearance: Powder or crystals, Storage: Sealed in dry, Room Temperature, Size: 1G
Supplier:  TCI America
Description:   6-Iodoindazole, Purity: >98.0%(GC), CAS Number: 261953-36-0, Molecular Formula: C7H5IN2, Molecular Weight: 244.04, Size: 5G
Supplier:  TCI America
Description:   CAS Number: 4733-50-0
MDL Number: MFCD00001790
Molecular Formula: C8H4N2O2
Molecular Weight: 160.13
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
MSDS SDS
Catalog Number: (TCD1235-100MG)

Supplier:  TCI America
Description:   CAS Number: 1576-67-6
MDL Number: MFCD00001170
Molecular Formula: C16H14
Molecular Weight: 206.29
Purity/Analysis Method: >97.0% (GC)
Form: Crystal
Melting point (°C): 141
MSDS SDS
Supplier:  AMBEED, INC
Description:   3,6-Di-tert-butyl-9-mesityl-10-methylacridin-10-ium tetrafluoroborate, Purity: 97%, CAS Number: 2054779-48-3, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1G
Supplier:  GOODFELLOW CORPORATION
Description:   Gold ≥99.99%, disk, as roll, Diameter 36 mm
New Product
Supplier:  Thermo Scientific Chemicals
Description:   Glucagon-Like Peptide-1 (7-36) amide, human
Supplier:  Thermo Scientific Chemicals
Description:   (S,S)-3,6-Dimethyl-1,4-dioxane-2,5-dione. Grade:98, Melting Point C95-98*. Boiling Point C:NA. C6H8O4. 4511-42-6. IRRITANT KEEP COLD MOISTURE SENSITIVE
MSDS SDS
Supplier:  AMBEED, INC
Description:   Di-tert-butyl(2',4',6'-triisopropyl-3,6-dimethoxy-[1,1'-biphenyl]-2-yl)phosphine 98%
New Product
Catalog Number: (103008-696)

Supplier:  Anaspec Inc
Description:   GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36)amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36)amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36)amide however was shown to exert cardioprotective actions in rodent hearts.
Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3089.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  AMBEED, INC
Description:   tert-Butyl 3,6-diazabicyclo[3.2.2]nonane-6-carboxylate 95%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,785 - 4,800  of 15,892