Text Search >
3-[1,1\'-Biphenyl]-4-ylacrylic acid
Print…
You Searched For:
165,777 results were found
3-[1,1\'-Biphenyl]-4-ylacrylic acid
Supplier:
Bachem Americas
Description:
Xenin 25, which has 6 C-terminal amino acids in common with amphibian xenopsin, has been detected in human gastric mucosa. It stimulates the exocrine pancreatic secretion. Xenin co-excreted with the incretin GIP has gained interest in diabetes research.
Catalog Number:
(95041-232)
Supplier:
HiMedia
Description:
Refined product providing a high-quality soluble source of amino acids, polypeptides, and peptides.
Supplier:
ALADDIN SCIENTIFIC
Description:
Reactant for: 1.Preparation of (aryl)oxadiazolobenzoxazinones via Suzuki-Miyaura reaction. 2.Copper-catalyzed oxidative amination of benzoxazoles and related azoles via C-H and C-N bond activation. 3.Synthesis of N-(alkoxyphenyl)-aminocarbonylbenzoic acid derivatives as protein tyrosine phophatase 1B inhibitors. 4. Preparation of lipophilic deoxy-xylulose-phosphate reductoisomerase inhibitors. 5.Synthesis of benzoxazole benzenesulfonamides as allosteric inhibitors of fructose-1,6-bisphosphatase.application:Reactant for:Preparation of (aryl)oxadiazolobenzoxazinones via Suzuki-Miyaura reactionCopper-catalyzed oxidative amination of benzoxazoles and related azoles via C-H and C-N bond activationSynthesis of N-(alkoxyphenyl)-aminocarbonylbenzoic acid derivatives as protein tyrosine phophatase 1B inhibitorsPreparation of lipophilic deoxy-xylulose-phosphate reductoisomerase inhibitorsSynthesis of benzoxazole benzenesulfonamides as allosteric inhibitors of fructose-1,6-bisphosphatase
Supplier:
Bachem Americas
Description:
The amyloid β-protein is a 39- to 43-amino acid polypeptide that is the primary constituent of senile plaques and cerebrovascular deposits in Alzheimer's disease and Down's syndrome. Additionally it acts as an inhibitor of the ubiquitin-dependent protein degradation in vitro.
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
DL-Leucine 99+%
Catalog Number:
(101810-004)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 020432-500MG , MDL Number: MFCD04341427
Supplier:
PeproTech, Inc.
Description:
CD40, a member of the TNF receptor superfamily, is a cell surface protein expressed on B cells, dendritic cells, monocytes, thymic epithelial cells and, at low levels, on T cells. Signaling though CD40 plays an important role in the proliferation and differentiation of B cells, and is critical for immunoglobulin (Ig) class switching. The membrane-anchored CD40-Ligand is expressed almost exclusively on activated CD4+ T lymphocytes. Failure to express CD40L leads to “immunodeficiency with hyper-IgM”, a disease characterized by failure to produce IgG, IgA and IgE. The human CD40L gene codes for a 261 amino acid type II transmembrane protein, which contains a 22 amino acid cytoplasmic domain, a 24 amino acid transmembrane domain, and a 215 amino acid extracellular domain. The soluble form of CD40L is an 18 kDa protein comprising the entire TNF homologous region of CD40L and is generated in vivo by an intracellular proteolytic processing of the full length CD40L. Recombinant Human soluble CD40 ligand is a 16.3 kDa protein containing 149 amino acid residues comprising the receptor binding TNF-like domain of CD40L. Manufactured using all Animal-Free reagents.
Supplier:
LGC STANDARDS
Description:
[2-[(2-Amino-4-chlorophenyl)amino]phenyl](4-methyl-1-piperazinyl)methanone, TRC, LGC Standards
Catalog Number:
(103007-536)
Supplier:
Anaspec Inc
Description:
This is amino acids 93 to 105 fragment of human leptin (anti-obesity protein). Leptin is a 167-amino acid plasma protein that is synthesized in adipose tissue and acts as a blood-borne hormone responsible for weight maintenance.
Sequence: NVIQISNDLENLR MW: 1527.7 Da % Peak area by HPLC: 95 Storage condition: -20° C
Supplier:
Adipogen
Description:
AMCA-X SE is an amine-reactive, UV-excitable, blue fluorescent dye.
Catalog Number:
(EM8.14986.0050)
Catalog Number:
(103003-050)
Supplier:
Anaspec Inc
Description:
Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7) MW: 3920.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042440-1G , MDL Number: MFCD02094111
Catalog Number:
(TCL0141-001G)
Supplier:
TCI America
Description:
[as an indicator for assay of Food Yellow No.4 (Tartrazine)]
CAS Number: 5141-20-8 MDL Number: MFCD00012121 Molecular Formula: C37H36N2O9S3 Molecular Weight: 792.84 Form: Crystal Color: Red
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
