Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

6-Bromothiazolo[4,5-b]pyrazin-2-amine


27,811  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"27811"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   CAS Number: 72688-90-5
MDL Number: MFCD00143779
Molecular Formula: C38H72N2PdS10
Molecular Weight: 984.03
Purity/Analysis Method: >90.0% (T)
Form: Crystal
Melting point (°C): 205
MSDS SDS
Supplier:  Matrix Scientific
Description:   Methyl {(4E)-5-oxo-1-phenyl-4-[1-(1H-pyrazol-3-ylamino)ethylidene]-4,5-dihydro-1H-pyrazol-3-yl}acetate
Supplier:  Matrix Scientific
Description:   Methyl (2E)-3-(dimethylamino)-2-{(4Z)-4-[(dimethylamino)methylene]-5-oxo-1-phenyl-4,5-dihydro-1H-pyrazol-3-yl}acrylate

Supplier:  Restek
Description:   Calibration standard Amine 900 Test Mix, 8 components, Concentration: In methanol:methylene chloride (50:50), Storage: 0 deg C or colder, Shelf Life: 1 months, Volume: 1 mL/ampule
Supplier:  TCI America
Description:   CAS Number: 68401-87-6 MDL Number: MFCD00059124 Molecular Formula: C22H36NNiS10 Molecular Weight: 693.83 Purity/Analysis Method: <gt/>98.0% (HPLC,T) Form: Crystal Color: Black
MSDS SDS
Catalog Number: (103006-368)

Supplier:  Anaspec Inc
Description:   BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   (4R,5S,6S)-(Pivaloyloxy)methyl 3-((1-(4,5-dihydrothiazol-2-yl)azetidin-3-yl)thio)-6-((R)-1-hydroxyethyl)-4-methyl-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylate, Purity: 98%, CAS number: 161715-24-8, Appearance: Solid, Storage: Sealed in dry, Store in freezer, under -20C, Size: 100MG
Catalog Number: (ABCA_AB108816-1X96)

Supplier:  ABCAM INC.
Description:   Rat BNP 45 ELISA Kit
New Product
Supplier:  LGC STANDARDS
Description:   7-Nitroso-3-(trifluoromethyl)-5,6,7,8-tetrahydro-[1,2,4]triazolo[4,3-a]pyrazine, TRC, LGC Standards
New Product
Supplier:  AMBEED, INC
Description:   2-((5-(3-(Dimethylamino)propyl)-2-methylpyridin-3-yl)amino)-9-(trifluoromethyl)-5,7-dihydro-6H-benzo[b]pyrimido[4,5-d]azepine-6-thione ≥98%
New Product

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Gap junction gamma-1 protein(GJC1) detection. Tested with WB in Human;Mouse;Rat.

Supplier:  CHEMetrics
Description:   Film Forming Amines Comparator 0-2 ppm, CHEMetrics
New Product
Supplier:  AMBEED, INC
Description:   N,N-Diethyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-amine, Purity: 98%, CAS Number: 1218791-45-7, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG
Supplier:  AMBEED, INC
Description:   (3aR,8aR)-(-)-4,4,8,8-Tetrakis(3,5-dimethylphenyl)tetrahydro-2,2-dimethyl-6-phenyl-1,3-dioxolo[4,5-e]dioxaphosphepin ≥98%
New Product

Supplier:  CHEMetrics
Description:   Filming Amines Instrumental Test Kit, CHEMetrics
New Product
Supplier:  AMBEED, INC
Description:   (2R,5S,13aR)-8-Hydroxy-7,9-dioxo-N-(2,4,6-trifluorobenzyl)-2,3,4,5,7,9,13,13a-octahydro-2,5-methanopyrido[1',2':4,5]pyrazino[2,1-b][1,3]oxazepine-10-carboxamide, Purity: 98%, CAS: 1611493-60-7, Appearance: White to light yellow solid, Storage: Sealed in dry, Store in freezer, under -20 C, Size: 5mg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,529 - 8,544  of 27,811