Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

6-Oxa-2-azaspiro[3.4]octane+oxalate


16,259  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"16259"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   Benzofuran-3(2H)-one, Purity: 97%, CAS Number: 7169-34-8, Appearance: Form: Crystal - Powder/Colour: White - Yellow, Storage: Keep in dark place, Sealed in dry, Store in freezer, under -20 C, Size: 10g
Supplier:  TCI America
Description:   CAS Number: 118727-34-7
Molecular Formula: C24H21N3
Molecular Weight: 351.45
Purity/Analysis Method: >93.0% (HPLC,T)
Form: Crystal
Color: White
Melting point (°C): 165
Supplier:  Novus Biologicals
Description:   Mouse Monoclonal Interleukin 34 Antibody (1D12). Tested Applications: Western Blot, ELISA, Flow Cytometry, Immunocytochemistry/Immunofluorescence. Tested Reactivity: Human.
Supplier:  TCI America
Description:   CAS Number: 2516-34-9
MDL Number: MFCD00001328
Molecular Formula: C4H9N
Molecular Weight: 71.12
Purity/Analysis Method: >97.0% (GC,T)
Form: Clear Liquid
Boiling point (°C): 82
Flash Point (°C): -1
Specific Gravity (20/20): 0.83
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  TCI America
Description:   3-Cyclohexylthiophene, Purity: >96.0%(GC), CAS Number: 120659-34-9, Molecular Formula: C10H14S, Molecular Weight: 166.28, form: Clear, Color: Very pale yellow - Yellow red, Size: 1G
Supplier:  AMBEED, INC
Description:   (S)-Ethyl 9,10-difluoro-3-methyl-7-oxo-3,7-dihydro-2H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylate, Purity: 97%, CAS number: 106939-34-8, Appearance: Light yellow to yellow powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 500G
Catalog Number: (102996-094)

Supplier:  Anaspec Inc
Description:   Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  AMBEED, INC
Description:   Dichloro(DPPE)digold(I), Purity: 98%, CAS Number: 18024-34-5, Appearance: White to off-white powder, Storage: Inert atmosphere, 2-8 C, Size: 250mg
Supplier:  AMBEED, INC
Description:   Ethyl 4-bromo-2-methylbenzoate 98%
Supplier:  AOB CHEM USA
Description:   1,2,3-Tribromo-5-isopropylbenzene ≥97%
Supplier:  AOB CHEM USA
Description:   3-tert-butyl-4-methoxybromobenzene ≥97%
Catalog Number: (H-4642.0005BA)

Supplier:  Bachem Americas
Description:   LHRH is also called Gonadotropin-Releasing Hormone (GnRH) or Luteinizing Hormone-Releasing Factor (LRF).
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 057032-5G , MDL Number: MFCD00016651
Supplier:  Thermo Scientific Chemicals
Description:   Potent inhibitor of EGF receptor kinase activity
MSDS SDS
Supplier:  Bachem Americas
Description:   Sequence: Z-Arg(Z)₂-OH
Supplier:  MP Biomedicals
Description:   Uridine-5'-diphosphoglucose Disodium Salt is a biosynthetic product produced by the reaction of UTP and glucose-1-phosphate catalyzed by uridyl transferase.
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,217 - 7,232  of 16,259