Boron+trifluoride+dimethyl+ether+complex
Catalog Number:
(80050-782)
Supplier:
MilliporeSigma
Description:
A fluorogenic substrate for detecting caspase-1 (ICE), caspase-4, and caspase-5 activity
Catalog Number:
(103007-214)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV Molecular Weight: 4328.9 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Supplier:
MilliporeSigma
Description:
A potent, specific, and reversible inhibitor of caspase-1 (Ki=200pM for human recombinant caspase-1) and caspase-4
Catalog Number:
(10321-862)
Supplier:
Bioss
Description:
IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Catalog Number:
(10321-864)
Supplier:
Bioss
Description:
IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Catalog Number:
(10290-078)
Supplier:
Bioss
Description:
This gene encodes a member of the epidermal growth factor(EGF) repeat superfamily. Members of this superfamily arecharacterized by the presence of EGF-like repeats and are ofteninvolved in the regulation of cell cycle, proliferation, anddevelopmental processes. The gene product contains a signalpeptide, suggesting that it is secreted; an EGF repeat regionconsisting of 4 complete EGF-like repeats and 1 partial EGF-likerepeat, 3 of which have a calcium-binding consensus sequence; anarg-gly-asp integrin association motif; and a MAM domain, which isbelieved to have an adhesive function. This gene is expressed earlyduring development, and its expression has been detected in lungand meningioma tumors. [provided by RefSeq, Jul 2008].
Catalog Number:
(10321-516)
Supplier:
Bioss
Description:
IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Catalog Number:
(10321-866)
Supplier:
Bioss
Description:
IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Catalog Number:
(10321-860)
Supplier:
Bioss
Description:
IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Catalog Number:
(10290-080)
Supplier:
Bioss
Description:
This gene encodes a member of the epidermal growth factor(EGF) repeat superfamily. Members of this superfamily arecharacterized by the presence of EGF-like repeats and are ofteninvolved in the regulation of cell cycle, proliferation, anddevelopmental processes. The gene product contains a signalpeptide, suggesting that it is secreted; an EGF repeat regionconsisting of 4 complete EGF-like repeats and 1 partial EGF-likerepeat, 3 of which have a calcium-binding consensus sequence; anarg-gly-asp integrin association motif; and a MAM domain, which isbelieved to have an adhesive function. This gene is expressed earlyduring development, and its expression has been detected in lungand meningioma tumors. [provided by RefSeq, Jul 2008].
Supplier:
VWR
Description:
A protease inhibitor of arginine-selective enzymes like trypsin, kallikrein and thrombin.
Catalog Number:
(10290-084)
Supplier:
Bioss
Description:
This gene encodes a member of the epidermal growth factor(EGF) repeat superfamily. Members of this superfamily arecharacterized by the presence of EGF-like repeats and are ofteninvolved in the regulation of cell cycle, proliferation, anddevelopmental processes. The gene product contains a signalpeptide, suggesting that it is secreted; an EGF repeat regionconsisting of 4 complete EGF-like repeats and 1 partial EGF-likerepeat, 3 of which have a calcium-binding consensus sequence; anarg-gly-asp integrin association motif; and a MAM domain, which isbelieved to have an adhesive function. This gene is expressed earlyduring development, and its expression has been detected in lungand meningioma tumors. [provided by RefSeq, Jul 2008].
Catalog Number:
(10289-982)
Supplier:
Bioss
Description:
This gene encodes a member of the epidermal growth factor(EGF) repeat superfamily. Members of this superfamily arecharacterized by the presence of EGF-like repeats and are ofteninvolved in the regulation of cell cycle, proliferation, anddevelopmental processes. The gene product contains a signalpeptide, suggesting that it is secreted; an EGF repeat regionconsisting of 4 complete EGF-like repeats and 1 partial EGF-likerepeat, 3 of which have a calcium-binding consensus sequence; anarg-gly-asp integrin association motif; and a MAM domain, which isbelieved to have an adhesive function. This gene is expressed earlyduring development, and its expression has been detected in lungand meningioma tumors. [provided by RefSeq, Jul 2008].
Catalog Number:
(103006-396)
Supplier:
Anaspec Inc
Description:
This cyclic RGD peptide contains a subsituted d-Tyr instead of d-Phe on the fourth position. Substitution with Tyr results in a high affinity and selectivity for the avb3 integrin. Substitution with Tyr also allows for electrophilic radiohalogenation if desired.
Sequence:Cyclo(-RGDyK) MW:619.7 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(89160-748)
Supplier:
Enzo Life Sciences
Description:
Histamine H₁ receptor antagonist. An antagonist of low affinity neurotensin receptors.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||