(S)-1-(3,5-Difluorophenyl)ethanol
Supplier:
PeproTech, Inc.
Description:
Klotho is a glycosylated protein that plays an important role in the regulation of phosphate and calcium homeostasis. Human Klotho exists in both membrane bound and secreted forms, and is predominantly expressed in the kidney convoluted tubules, and, to a lesser extent, in the brain, reproductive organs, endocrine glands, urinary bladder, skeletal muscle, placenta, and colon. The full length transmembrane form has a large extracellular domain composed of two homologous subunits termed KL1 and KL2, which contain 516 and 439 amino acid residues, respectively. The predominant circulating form, which is derived from alternative RNA splicing, contains the KL1 subunit and constitutes the N-terminal sequence of transmembrane Klotho. A third Klotho protein of about 128 kDa has been identified in the blood and cerebrospinal fluid. This circulating protein arises from the action of an as yet unidentified protease, which cleaves transmembrane Klotho just above and/or within the plasma membrane. Klotho has been shown to play a key role in the signaling cascade of fibroblast growth factor-23 (FGF-23), a bone-derived hormone that acts in the kidney to inhibit phosphate reabsorption and vitamin D biosynthesis. Klotho promotes FGF-23 signaling through binding to FGFRI (IIIc) which converts this canonical FGF receptor into a specific receptor for FGF-23. In the absence of Klotho the function of FGF-23 is literally abolished. Recombinant Human Klotho is a glycoprotein of 516 amino acid residues that migrates at an apparent molecular weight of 65-70 kDa by SDS-PAGE analysis under reducing conditions. Recombinant Human Klotho has a calculated molecular weight of 58.6 kDa.
Catalog Number:
(102996-410)
Supplier:
Anaspec Inc
Description:
Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin) MW: 4472.2 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(75932-920)
Supplier:
Rockland Immunochemical
Description:
Tail-interacting protein (TIP47) is a cytosolic protein essential for the transport of mannose-6-phosphate receptors (MPRs) from endosomes to the trans-Golgi compartments in cells. TIP47 is recruited from the cytoplasm to the late endosomal surface by the Ras-associated protein Rab9 GTPase, enabling it to bind more efficiently to MPR cytoplasmic domains. Recently, it was shown that TIP47 regulates the expression of Rab9, as expression of siRNA to TIP47 in transfected cells dramatically decreased the half-life of the Rab9 protein in addition to stabilizing the subcellular localization of Rab9. At least two isoforms of TIP47 are known to exist.
Supplier:
Adipogen
Description:
7-Azido-4-methylcoumarin is a highly sensitive and selective fluorogenic H2S probe. The aromatic azide moiety of AzMC is selectively reduced in the presence of H2S, producing the fluorescent 7-amino-4-methylcoumarin (AMC) with a concomitant increase in fluorescence with lambdaex = 365 nm and lambdaem = 450 nm. It is a photoaffinity labeling probe for the substrate binding site of human sulfotransferase 1A1 (SULT1A1). 7-Azido-4-methylcoumarin is a tool for monitoring the activity of pyridoxal-5'-phosphate (PLP)-dependent enzymes (e.g. cystathionine beta-synthase (CBS), cystathionine gamma-lyase (CGL) and tryptophan synthase (TS)) and to identify novel cystathionine beta-synthase (CBS) inhibitors and activators.
Supplier:
Macherey-Nagel
Description:
A range of analytical reagents for photometric water analysis in the NANOCOLOR® standard test version.
Catalog Number:
(10469-050)
Supplier:
Bioss
Description:
Regulates RHOA activity, and plays a role in cytoskeleton remodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between membranes (By similarity). Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.
Catalog Number:
(10257-086)
Supplier:
Bioss
Description:
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). May play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.
Catalog Number:
(75842-464)
Supplier:
BIOGEMS INTERNATIONAL INC.
Description:
The LTF-2 monoclonal antibody is used as an Isotype Control immunoglobulin for rat IgG2b antibodies.
Catalog Number:
(100243-522)
Supplier:
Southern Biotechnology
Description:
CD45R, also known as B220, a member of the protein tyrosine phosphate family and a major cell surface glycoprotein, represents a restricted form of the CD45 family which primarily recognizes only cells of B-lineage from pro-B cell through mature B lymphocytes and prior to the availability of anti-CD19 monoclonal antibodies was commonly used as a pan B-cell marker. It also reacts with certain activated T cells as well as non-MHC-restricted lytically active lymphokine-activated killer (LAK) cells. In vivo administration of RA3-6B2 has been shown to affect differentiation of both T and B cells in normal mice and reduce the level of anti-DNA antibodies and lymphadenopathies in MRL/lpr mice.
Catalog Number:
(10358-054)
Supplier:
Bioss
Description:
Insulin is a pancreatic hormone that regulates glucose and is involved in the synthesis of protein and fat. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Heterodimer of a B chain and an A chain linked by two disulfide bonds.Belongs to the insulin family. The insulin-link growth factors, IGF-I and IGF-II (also desinated somatomedin C and multiplication stimulating activator, respectvely), share approximatly 76% sequence identity and are 50% related to pro-insulin.IGF-I and IGF-II are nonglycosylated, single chain proteins of 70 and 76 amino acids in length, respectivelly. IGF-I functions as an autocrine regulator of growth in vaious, whereas the function of IGF-II is less well defined.
Catalog Number:
(76085-112)
Supplier:
Bioss
Description:
ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with a concomitant hydrolysis of ATP to ADP and phosphate. The product, acetyl-CoA, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis. In nervous tissue, ATP citrate-lyase may be involved in the biosynthesis of acetylcholine. Two transcript variants encoding distinct isoforms have been identified for this gene.
Catalog Number:
(76193-610)
Supplier:
Prosci
Description:
Acid phosphatases (AP) are a broad family of enzymes that differ widely in their AA length and homology, molecular weight and tissue of origin. They function to remove phosphate groups (or dephosphorylate) from proteins and perform best under acidic conditions. Disease states are sometimes characterized by abnormally high or low levels of Acid phosphatase, leading to them being used as serological and histological disease markers. Prostatic Acid Phosphatase (PAP) was initially used as a prostate cancer marker but was later replaced with Prostate Serum Antigen (PSA), a more sensitive early stage cancer marker.
Catalog Number:
(75842-474)
Supplier:
BIOGEMS INTERNATIONAL INC.
Description:
The HRPN monoclonal antibody is used as an Isotype Control immunoglobulin for rat IgG1 antibodies.
Catalog Number:
(10300-158)
Supplier:
Bioss
Description:
G protein-coupled receptors (GPCRs), also designated seven transmembrane (7TM) receptors and heptahelical receptors, are a protein family which interacts with G proteins (heterotrimeric GTPases) to synthesize intracellular second messengers such as diacylglycerol, cyclic AMP, inositol phosphates and calcium ions. Their diverse biological functions range from vision and olfaction to neuronal and endocrine signaling, along with involvement in many pathological conditions. GPR31 (G-protein coupled receptor 31) is a 319 amino acid orphan receptor that localizes to the cell membrane. GPR31 shares 25-33% homology with members of the chemokine, purino and somatostatin receptor gene families.
Catalog Number:
(75790-956)
Supplier:
Prosci
Description:
Calcitonin is a secreted protein which belongs to the calcitonin family. Calcitonin is cleaved into the following two chains: Calcitonin and Katacalcin. Katacalcin is a potent plasma calcium-lowering peptide. Calcitonin is a 32-amino acid linear polypeptide hormone. Calcitonin acts to reduce blood calcium (Ca2+), opposing the effects of parathyroid hormone (PTH). Its importance in humans has not been as well established as its importance in other animals, as its function is usually not significant in the regulation of normal calcium homeostasis. Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Supplier:
Biolegend
Description:
PE anti-mouse CD6 [OX-129]; Isotype: Rat IgG2a, κ; Reactivity: Mouse; Apps: FC; Size: 100 μg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||