Text Search >
Acridine+orange+(hemizinc+salt)
Print…
You Searched For:
17,950 results were found
Acridine+orange+(hemizinc+salt)
Catalog Number:
(TCD0821-25G)
Supplier:
TCI America
Description:
CAS Number: 885-62-1
MDL Number: MFCD00007471 Molecular Formula: C6H4N2O7S Molecular Weight: 270.15 Purity/Analysis Method: >98.0% (HPLC,T) Form: Crystal
Supplier:
TCI America
Description:
CAS Number: 6148-64-7
MDL Number: MFCD00035603 Molecular Formula: C5H8O4 Molecular Weight: 170.21 Purity/Analysis Method: >98.0% (T) Form: Crystal Melting point (°C): 200
Catalog Number:
(TS34770-1000)
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
Lithium bis(trimethylsilyl)amide, 1M solution in THF/Ethylbenzene, AcroSeal, Size: 100ml
Catalog Number:
(89158-064)
Supplier:
Enzo Life Sciences
Description:
Weak histone deacetylase (HDAC) inhibitor. Induces differentiation, growth arrest and apoptosis in a number of cell lines. Protects against cerebral ischemic injury and displays neuroprotective effect in a mouse model of Huntington’s disease. Anti-neoplastic agent and transcriptional regulator. Also acts as an inducer of tumor cytostasis and differentiation. Shows chemical chaperone activity.
Catalog Number:
(77984-443)
Supplier:
LGC STANDARDS
Description:
11-(4-Ethyl-1-piperazinyl)-dibenzo[b,f][1,4]thiazepine Dihydrochloride, TRC, LGC Standards
Catalog Number:
(71003-316)
Supplier:
G-Biosciences
Description:
Synonym: synonym: ammonium peroxodisulfate. molecular formula: h ?n ?o ?s ? molecular weight: 228.18
Catalog Number:
(76180-676)
Supplier:
MP Biomedicals
Description:
Trypan Blue is a blue acid dye with a strong affinity for cellulose containing substrates such as cotton; less affinity for proteinaceous materials. Trypan blue solution may be used in trypan blue based cytotoxicity and proliferation assays.
Trypan Blue is used as a vital dye which is especially important because it is taken up by the reticuloendothelial system. Clark describes assays for the study of teratogenic action of trypan blue on embryonic tissues using Davis and Sauter's fluorescence method and for the staining of collagen, including very fine fibrils, muscle and cornified epithelium using the Van Gieson method. Trypan blue is also recommended for use in dye exclusion procedures for viable cell counting. Non-viable cells will up-take trypan blue at a faster rate than viable cells.
Supplier:
Bachem Americas
Description:
The Italian mutation of β-amyloid 1-40 (E22K) aggregates more rapidly than the wild-type sequence 1-40. It showed increased neurotoxicity, which (according to a solid-phase NMR-study of Masuda et al.) may be due to the salt bridge formed between Lys²² and Asp²³ in the minor conformer. As the Arctic, Flemish, and Dutch mutants, the Italian mutant is degraded considerably more slowly than wild-type Aβ by neprilysin.
Catalog Number:
(EM1.05445.0500)
Catalog Number:
(10101-092)
Supplier:
Prosci
Description:
CLCNKA is a member of the CLC family of voltage-gated chloride channels. It is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene.
Catalog Number:
(103008-246)
Supplier:
Anaspec Inc
Description:
Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt MW: 3949.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Supplier:
AMBEED, INC
Description:
Boc-L-allylglycine . DCHA 97%
Catalog Number:
(IC15286001)
Supplier:
MP Biomedicals
Description:
Caerulein is a gastroregulatory molecule with actions similar to cholecystokinin. Product supplied as a trifluoroacetate salt.
Supplier:
BeanTown Chemical
Description:
CAS: 143-66-8; EC No: 205-605-5; MDL No: MFCD00011494; RTECS: ED3362500
UN No: UN2811; Haz Class: 6.1; Packing Group: III
Solid; Linear Formula: (C6H5)4BNa; Molecular Formula: C24H20BNa ; MW: 342.23
Melting Point: <gt/>300°
Light Sensitive
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
