Text Search >
Acridine+orange+(hemizinc+salt)
Print…
You Searched For:
17,949 results were found
Acridine+orange+(hemizinc+salt)
Supplier:
Strem Chemicals Inc
Description:
CAS #: 6156-78-1. Size: 25g.
Supplier:
TCI America
Description:
CAS Number: 274257-34-0
MDL Number: MFCD03790006 Molecular Formula: C7H7BF3K Molecular Weight: 198.04 Purity/Analysis Method: >98.0% (HPLC) Form: Crystal Color: White Melting point (°C): 226
Supplier:
MP Biomedicals
Description:
Sodium Selenite, Purity: approx 98%, Cas Number: 10102-18-8, Formula: Na2Seo3, Molecular Weight: 172.94, Appearance: Pale Gray Powder, Synonyms Selenious Acid, Disodium, Disodium Selenite, Natriumselenit, Selenious Acid, Disodium Salt, Cell Culture Reagent, Size: 10 G
Catalog Number:
(TCB0112-025G)
Supplier:
TCI America
Description:
CAS Number: 22513-32-2
MDL Number: MFCD00058967 Molecular Formula: C7H7NO2 Molecular Weight: 159.12 Purity/Analysis Method: >98.0% (HPLC,T) Form: Crystal
Catalog Number:
(76180-676)
Supplier:
MP Biomedicals
Description:
Trypan Blue is a blue acid dye with a strong affinity for cellulose containing substrates such as cotton; less affinity for proteinaceous materials. Trypan blue solution may be used in trypan blue based cytotoxicity and proliferation assays.
Trypan Blue is used as a vital dye which is especially important because it is taken up by the reticuloendothelial system. Clark describes assays for the study of teratogenic action of trypan blue on embryonic tissues using Davis and Sauter's fluorescence method and for the staining of collagen, including very fine fibrils, muscle and cornified epithelium using the Van Gieson method. Trypan blue is also recommended for use in dye exclusion procedures for viable cell counting. Non-viable cells will up-take trypan blue at a faster rate than viable cells.
Supplier:
Thermo Scientific Chemicals
Description:
Fieser: 1,537 9,265 12,270 13,155 14,188 16,193 19,184 20,209 21,245
Supplier:
BeanTown Chemical
Description:
CAS: 7727-54-0; EC No: 231-786-5; MDL No: MFCD00003390; RTECS: SE0350000
UN No: UN1444; Haz Class: 5.1; Packing Group: III
Lump; Linear Formula: (NH4)2S2O8; MW: 228.20
Moisture Sensitive
Catalog Number:
(71003-316)
Supplier:
G-Biosciences
Description:
Synonym: synonym: ammonium peroxodisulfate. molecular formula: h ?n ?o ?s ? molecular weight: 228.18
Catalog Number:
(10101-092)
Supplier:
Prosci
Description:
CLCNKA is a member of the CLC family of voltage-gated chloride channels. It is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene.
Catalog Number:
(76262-758)
Supplier:
Rockland Immunochemical
Description:
Bile Salt Export Pump (BSEP) is a protein which in humans is encoded by the ABCB 11 gene. It is a member of the superfamily of ATP-binding cassette (ABC) transporters, also known as ABCB11. It is mapped to chromosome 2q24. The BSEP protein is mainly expressed in the liver. ABCB11 is a gene associated with progressive familial intrahepatic cholestasis type 2 (PFIC2) which caused by mutations in the ABCB11 gene will increases the risk of hepatocellular carcinoma in early life. This antibody is suitable for researchers interested in signal transduction and cancer research.
Supplier:
TCI America
Description:
CAS Number: 546-89-4
Molecular Formula: C2H4O2 Molecular Weight: 65.98 Purity/Analysis Method: >98.0% (T) Form: Crystal Melting point (°C): 283
Catalog Number:
(103008-246)
Supplier:
Anaspec Inc
Description:
Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt MW: 3949.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Supplier:
MP Biomedicals
Description:
~28 IU/mg, Powder
Supplier:
MP Biomedicals
Description:
White Powder
Catalog Number:
(EM1.05445.0500)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
