Text Search >
Formaldehyde+sodium+bisulfite
Print…
You Searched For:
15,336 results were found
Formaldehyde+sodium+bisulfite
Supplier:
BeanTown Chemical
Description:
CAS: 75-65-0; EC No: 200-889-7; MDL No: MFCD00004464; RTECS: EO1925000
UN No: UN1120; Haz Class: 3; Packing Group: II
Liquid; Linear Formula: (CH3)3COH; Molecular Formula: C4H10O ; MW: 74.12
Melting Point: 23-26°; Boiling Point: 83°; Flash point: 11°C (52°F)
Density (g/mL): 0.775; Refractive Index: 1.387
Supplier:
Enzo Life Sciences
Description:
The proteasome is widely recognised as the central enzyme of non-lysosomal protein degradation. It is responsible for intracellular protein turnover and it is also critically involved in many regulatory processes and, in higher eukaryotes, in antigen processing. The 26S proteasome is the key enzyme of the ubiquitin/ATP-dependent pathway of protein degradation. The catalytic core of this unusually large (2000kDa, 450Å in length) complex is formed by the 20S proteasome, a barrel shaped structure shown by electron microscopy to comprise of four rings each containing seven subunits.
Based on sequence similarity, all fourteen 20S proteasomal subunit sequences may be classified into two groups, α and β, each group having distinct structural and functional roles. The α-subunits comprise the outer rings and the β-subunits the inner rings of the 20S proteasome. Observations of the eukaryotic proteasome and analysis of subunit sequences indicate that each ring contains seven different subunits (α7β7β7α7) with a member of each sub-family represented in each particle. Each subunit is located in a unique position within the α- or β-rings. 120S Proteasomes degrade only unfolded proteins in an energy-independent manner, whereas 26S proteasomes degrade native and ubiquitinylated proteins in an ATP-dependent manner. The native protein substrates are recognised by subunits, some with ATP binding sites, of the outer 19S caps of the 26S proteasome.
Catalog Number:
(103007-636)
Supplier:
Anaspec Inc
Description:
Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV Molecular Weight: 4345.9 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Supplier:
Thermo Scientific Chemicals
Description:
MDL: MFCD00000328
Beilstein Registry No.: 2046068
Supplier:
BeanTown Chemical
Description:
CAS: 998-30-1; EC No: 213-650-7; MDL No: MFCD00009061; RTECS: VV6682000
UN No: UN3384; Haz Class: 6.1 (3); Packing Group: I
Liquid; Linear Formula: (CH3CH2O)3SiH; Molecular Formula: C6H16O3Si; MW: 164.28
Melting Point: -170°; Boiling Point: 134-135°; Flash point: 26°C (79°F)
Density (g/mL): 0.885 ; Refractive Index: 1.377
Moisture Sensitive
Supplier:
Matrix Scientific
Description:
MF=C8H5CLF2O MW=190.58 CAS=1017777-45-5 MDL=MFCD09832259 1G
Supplier:
TCI America
Description:
CAS Number: 106-89-8
MDL Number: MFCD00005132 Molecular Formula: C3H5ClO Molecular Weight: 92.52 Purity/Analysis Method: >99.0% (GC) Form: Clear Liquid Boiling point (°C): 117 Melting point (°C): -26 Flash Point (°C): 32 Specific Gravity (20/20): 1.18
Catalog Number:
(TS21429-0050)
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
2',6'-Difluoroacetophenone 98%
Supplier:
BeanTown Chemical
Description:
CAS: 110-54-3; EC No: 203-777-6; MDL No: MFCD00009520; RTECS: MN9275000
UN No: UN1208; Haz Class: 3; Packing Group: II
Liquid, distilled in glass; Linear Formula: CH3(CH2)4CH3; Molecular Formula: C6H14; MW: 86.18
Melting Point: -95°; Boiling Point: 69°; Flash point: -26°C (-15°F)
Density (g/mL): 0.659; Refractive Index: 1.375
Catalog Number:
(RK31010)
Supplier:
Restek
Description:
SV Calibration mix #4 contains carbazole (86-74-8); dibenzofuran (132-64-9); diethyl phthalate (84-66-2); 2,4-dinitrotoluene (121-14-2); 2,6-dinitrotoluene (606-20-2); hexachlorobenzene (118-74-1); hexachlorobutadiene (87-68-3); hexachlorocyclopentadiene (77-47-4); hexachloroethane (67-72-1); isophorone (78-59-1); 2-methylnaphthalene (91-57-6); nitrobenzene (98-95-3); 1,2,4-trichlorobenzene (120-82-1).
Supplier:
BeanTown Chemical
Description:
CAS: 464-07-3; EC No: 207-347-9; MDL No: MFCD00004522; RTECS: EL2276000
UN No: UN1987; Haz Class: 3; Packing Group: III
Liquid; Linear Formula: (CH3)3CCH(OH)CH3; Molecular Formula: C6H14O; MW: 102.17
Melting Point: 4.8°; Boiling Point: 119-121°; Flash point: 26°C (79°F)
Density (g/mL): 0.812; Refractive Index: 1.415
Catalog Number:
(MSPP-SEB695HU)
Supplier:
CLOUD-CLONE CORP MS
Description:
This assay has high sensitivity and excellent specificity for detecting Human IL26 (Interleukin 26). The assay range is from 15.6 to 1000 pg/ml (Sandwich kit) with a sensitivity of 6.2 pg/ml. There is no detectable cross-reactivity with other relevant proteins. Activity loss rate and accelerated stability test ect have been conducted to guarantee the best performance of the products after long storage and delivery.
Catalog Number:
(TCN0424-25ML)
Supplier:
TCI America
Description:
CAS Number: 3301-94-8
MDL Number: MFCD00036500 Molecular Formula: C9H16O2 Molecular Weight: 156.23 Purity/Analysis Method: >98.0% (GC) Form: Clear Liquid Boiling point (°C): 137 Melting point (°C): -26 Flash Point (°C): 137 Specific Gravity (20/20): 0.99
Supplier:
TCI America
Description:
[for NMR]
CAS Number: 75-76-3 MDL Number: MFCD00008274 Molecular Formula: C4H12Si Molecular Weight: 88.23 Purity/Analysis Method: >99.0% (GC) Form: Clear Liquid Color: Colorless Boiling point (°C): 26 Flash Point (°C): -27 Specific Gravity (20/20): 0.64 Storage Temperature: 0-10°C
Catalog Number:
(75791-276)
Supplier:
Prosci
Description:
6-phosphofructokinase, muscle type is a muscle-type isozyme that in humans is encoded by the PFKM gene. It belongs to the phosphofructokinase family and Two domains subfamily. PFKM functions as subunits of the mammalian tetramer phosphofructokinase, which catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-bisphosphate. PFK1 converts fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2) and ADP.
Supplier:
TCI America
Description:
CAS Number: 42969-65-3
MDL Number: MFCD00211237 Molecular Formula: C4H6O Molecular Weight: 70.09 Purity/Analysis Method: >98.0% (GC) Form: Clear Liquid Boiling point (°C): 103 Flash Point (°C): 26 Specific Gravity (20/20): 0.89 Specific rotation [a]20/D: 47 deg (neat)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
