Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

You Searched For:

BMS-582949


474  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"474"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Stemcell Technologies
Description:   For the in vitro differentiation of human MSCs into osteoblasts.
Supplier:  TCI America
Description:   CAS Number: 13292-87-0
MDL Number: MFCD00013189
Molecular Formula: C2H9BS
Molecular Weight: 75.96
Purity/Analysis Method: >90.0% (T)
Form: Clear Liquid
Flash Point (°C): 18
Specific Gravity (20/20): 0.80
Storage Temperature: 0-10°C
MSDS SDS

Supplier:  Anaspec Inc
Description:   This is a fluorescent 5-FAM labeled scrambled Beta-Amyloid peptide, Abs/Em=494/521 nm.
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
MW: 4873.4
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (103659-344)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Mouse Osteonectin / SPARC (rM Osteonectin / SPARC; Catalog#50494-M08H; NP_033268.1; Met 1-Ile 302). Total IgG was purified by Protein A affinity chromatography.
Catalog Number: (89041-050)

Supplier:  PIP
Description:   The QRP BF finger cots are manufactured from a proven 100% natural latex formula blended with USDA-compliant blue coloring to eliminate blue rub-off and residue.

Supplier:  Sino Biological
Description:   This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human Osteonectin / SPARC (rh Osteonectin / SPARC; Catalog#10929-H08H; NP_003109.1; Met1-Ile303). The IgG fraction of the cell culture supernatant was purified by Protein A affinity chromatography.
Catalog Number: (MSPP-04636)

Supplier:  Stemcell Technologies
Description:   Serum-free methylcellulose-based medium with recombinant cytokines for human ES and iPS cell-derived cells.

Supplier:  Stemcell Technologies
Description:   Serum-free culture supplement for expansion of human erythroid cells.

Supplier:  Stemcell Technologies
Description:   Serum-free culture supplement for expansion and differentiation of human granulocytes.
Supplier:  Bon Opus Biosciences
Description:   Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier:  Yamato Scientific
Description:   The compact design and simple set-up systems make these water baths easy to use with rotary evaporators.
Supplier:  Berkshire
Description:   Durx® 670 AS for Aerospace (AS) is a hydroentangled, non-woven blend of 55% cellulose and 45% polyester with no binders or other chemical additives. This wiper meets the AMS 3819D, Class 2, Grade A, Form 1 requirements.
Catalog Number: (103659-350)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Mouse Osteonectin / SPARC (rM Osteonectin / SPARC; Catalog#50494-M08H; NP_033268.1; Met 1-Ile 302). Osteonectin / SPARC specific IgG was purified by Mouse Osteonectin / SPARC affinity chromatography.
Supplier:  Berkshire
Description:   SatPax® 670 AS for Aerospace combines Durx® 670 non-woven wipers with 70% IPA/30% DI water to create a pre-wetted wiper that is effective and easy to use.
Supplier:  Promocell, Inc.
Description:   PromoCell Mesenchymal Stem Cell Media were developed for the in vitro expansion and directed differentiation of mesenchymal stem cells (MSC) from bone marrow, the umbilical cord matrix (Wharton´s Jelly) and adipose tissue
MSDS SDS
Supplier:  Berkshire
Description:   MicroSeal SuperSorb® AS for Aerospace is a high sorbency, ultrasonically sealed edge cleanroom laundered two-ply wiper that meets AMS 3819D, Class 4, Grade A, Form 1 requirements.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
433 - 448  of 474
Prev   28  29  30  Next