Text Search >
2,5-Dimethoxy-6-fluorophenylboronic+acid
Print…
You Searched For:
17,033 results were found
2,5-Dimethoxy-6-fluorophenylboronic+acid
Catalog Number:
(75789-308)
Supplier:
Prosci
Description:
Endothelial Cell Adhesion Molecule (ESAM) is a 55 kDa type I transmembrane glycoprotein member of the JAM family of immunoglobulin superfamily molecules. The 390 amino acid Human ESAM contains a 216 amino acid extracellular domain (ECD) with a V-type and a C2-type immunoglobulin (Ig) domain. ESAM is specifically expressed at endothelial tight junctions and on activated platelets and performs homophilic adhesion activity. The adaptor protein membrane-associated guanylate kinase MAGI-1 has been identified as an intracellular binding partner of ESAM. In addition, ESAM at endothelial tight junctions participates in the migration of neutrophils through the vessel wall, possibly by influencing endothelial cell contacts. ESAM-deficient mice were described with lowered angiogenic potential, and accordingly, overexpression of ESAM is closely associated with certain tumor growth and metastasis. ESAM is expressed on endothelial cells, activated platelets and megakaryocytes. The ECD of human and mouse ESAM share 69% amino acid identity.
Supplier:
Bachem Americas
Description:
Sequence: Fmoc-N-Me-Phe-OH
Supplier:
Thermo Scientific Chemicals
Description:
A bacteriostatic sulfonamide antibiotic which acts as a folic acid synthesis inhibitor
Catalog Number:
(10451-480)
Supplier:
Bioss
Description:
Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier.
Supplier:
Bachem Americas
Description:
Sequence: H-β-Chloro-Ala-OH · HCl
Supplier:
Bachem Americas
Description:
Sequence: H-β-(3-Benzothienyl)-Ala-OH
Supplier:
Biotium
Description:
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Supplier:
Biotium
Description:
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Supplier:
Biotium
Description:
This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Supplier:
ALADDIN SCIENTIFIC
Description:
AT-406 ≥98%, Moligand™
Catalog Number:
(76418-048)
Supplier:
Enzo Life Sciences
Description:
Produced in <i>E. coli</i>. Contains 466 amino acids.
Supplier:
Anaspec Inc
Description:
PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 MW:4309.8 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
Promega Corporation
Description:
Recombinant human MET (amino acids 956-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. MET is a proto-oncogene that encodes a transmembrane growth factor receptor.
Catalog Number:
(80056-726)
Supplier:
MilliporeSigma
Description:
(L-5-HTP). Off-white solid. PROTECT FROM LIGHT. Serotonin precursor. Purity: >= 95% by HPLC. Soluble in acidic solutions and H2O. RTECS YN7110000, CAS 4350-09-8, M.W. 220.2. WARNING! Harmful. LD50 of <= 2000 mg/kg.
Catalog Number:
(76193-608)
Supplier:
Prosci
Description:
Acid phosphatases are a broad family of enzymes that differ widely in their amino acid length and homology, molecular weight and tissue of origin. They function to remove phosphate groups (or dephosphorylate) from proteins and perform best under acidic conditions. Disease states are sometimes characterized by abnormally high or low levels of Acid Phosphatase, leading to them being used as serological and histological disease markers. Prostatic Acid Phosphatase (PAP) was initially used as a prostate cancer marker but was later replaced with Prostate Serum Antigen (PSA), a more sensitive early stage cancer marker.
Catalog Number:
(103681-214)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the amino acids (Met 1-Thr 765) of human SEMA5A (NP_003957.2) extracellular domain was fused with Fc region of human IgG1 at the C-terminus.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
