Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Bis(p-tolyl)phosphine+oxide


20,891  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"20891"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103007-366)

Supplier:  Anaspec Inc
Description:   This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Strem Chemicals Inc
Description:   CAS #: 1303-86-2. Size: 250g.
Supplier:  Thermo Scientific Chemicals
MSDS SDS

Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse neuronal Nitric Oxide Synthase(nNOS) ELISA Kit
Supplier:  AFG BIOSCIENCE LLC
Description:   Rat Endothelial Nitric Oxide Synthase 3 (eNOS-3) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Neuronal Nitric Oxide Synthase (nNOS) ELISA Kit
Supplier:  Teknova
Description:   DNase, RNase and Protease tested Teknova Cell Culture Grade Water.
Supplier:  Promega Corporation
Description:   The NAD/NADH-Glo Assay is a bioluminescent, homogeneous single-reagent-addition assay for detecting total oxidized and reduced nicotinamide adenine dinucleotides and determining their ratio in biological samples or in defined enzyme reactions.
MSDS SDS
Supplier:  Medicom
Description:   Intended for sterilization in steam autoclaves or via Ethylene Oxide (EO). The pouch's process indicators are designed to indicate to the user that the pouch has undergone either a steam or EO sterilization process.
New Product
Catalog Number: (77004-946)

Supplier:  AMBEED, INC
Description:   2-(((Dimethylamino)(dimethyliminio)methyl)thio)pyridine 1-oxide tetrafluoroborate, Purity: 98%, CAS number: 255825-38-8, Appearance: Form: solid Colour: off-white, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 5G
Supplier:  Restek
Description:   Oxidation-resistant, chrome-plated dual-stage brass gas regulators are ideal for sensitive GC applications using MS, PID, or ECD detection methods.

Supplier:  Bioss
Description:   Aldehydic products of lipid peroxidation, such as 4 hydroxynonenal (4 HNE), have been implicated in the etiology of pathological changes under oxidative stress as a key mediator of oxidative stress induced cell death. It is a stable product of lipid peroxidation, is proarrhythmic and may contribute to the cytotoxic effects of oxidative stress

4-HNE has been hypothesized to play a key role in cell signal transduction, in a variety of pathways from cell cycle events to cellular adhesion.
Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse Soluble Lectin-like Oxidized Low Density Lipoprotein Receptor-1(sLOX-1) ELISA Kit
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00149778
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 286-20-4; EC No: 206-007-7; MDL No: MFCD00005162; RTECS: RN7175000 UN No: UN2920; Haz Class: 8 (3); Packing Group: II Liquid; Molecular Formula: C6H10O; MW: 98.15 Boiling Point: 129-130°; Flash point: 24°C (75°F) Density (g/mL): 0.97; Refractive Index: 1.452
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Grade: 97, Melting Point C<-40*. Boiling Point C: 112-113*. C3H5ClO2. 38870-89-2. Stabilised with magnesium oxide. FLAMMABLE CORROSIVE POSSIBLE CARCINOGEN MOISTURE SENSITIVE
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,257 - 4,272  of 20,891