Text Search >
Boc-Cys(SEt)-OH·DCHA
Print…
You Searched For:
39,101 results were found
Boc-Cys(SEt)-OH·DCHA
Supplier:
Thermo Scientific Chemicals
Description:
N-Fmoc-S-trityl-L-cysteine pentafluorophenyl ester, Purity: 98%, CAS Number: 115520-21-3, molecular formula: C43H30F5NO4S, Synonyms: Fmoc-Cys(Trt)-Opfp, 1g
Catalog Number:
(RL603145126)
Supplier:
Rockland Immunochemical
Description:
Secondary Antibody for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug
Catalog Number:
(10001-892)
Supplier:
Biotium
Description:
Goat anti-human IgG, Fc gamma specific antibody reacts specifically with the human IgG heavy (γ) chains and not with light chains and F(ab’)2 fragment on all human immunoglobulins. To minimize cross-reactivity, it has been adsorbed against bovine, horse, mouse and rabbit serum proteins prior to conjugation. CF™640R (Ex/Em 642/662 nm) is a novel far-red rhodamine-based dye spectrally similar to Cy®5 and Alexa Fluor® 647. CF™640R is much brighter than Cy®5 and at least as bright as Alexa Fluor® 647 when excited at 633 or 635 nm. However, the most important advantage of CF™640R is its exceptional photostability.
Alexa Fluor® is a registered trademark of Thermo Fisher Scientific. Cy®5 is a registered trademark of GE Healthcare.
Catalog Number:
(RL603141126)
Supplier:
Rockland Immunochemical
Description:
Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates 100ug
Catalog Number:
(10813-660)
Supplier:
Prosci
Description:
The MDC gene is one of several Cys-Cys (CC) cytokine genes which are clustered on the q arm of chromosome 16.
Catalog Number:
(10001-922)
Supplier:
Biotium
Description:
Llama anti-rabbit CF™ dye conjugates are prepared by labeling affinity purified llama anti-rabbit IgG (H+L) with a selection of CF™ dyes. CF™ dyes offer combined advantages in brightness, photostability, and specificity compared other fluorescent dyes. CF™640R (Ex/Em 642/662 nm) is a novel far-red rhodamine-based dye spectrally similar to Cy®5 and Alexa Fluor® 647. CF™640R is much brighter than Cy®5 and at least as bright as Alexa Fluor® 647 when excited at 633 or 635 nm. However, the most important advantage of CF™640R is its exceptional photostability.
Alexa Fluor® is a registered trademark of Thermo Fisher Scientific. Cy®5 is a registered trademark of GE Healthcare.
Supplier:
Biotium
Description:
Llama anti-rabbit CF™ dye conjugates are prepared by labeling affinity purified llama anti-rabbit IgG (H+L) with a selection of CF™ dyes. CF™ dyes offer combined advantages in brightness, photostability, and specificity compared other fluorescent dyes. CF™640R (Ex/Em 642/662 nm) is a novel far-red rhodamine-based dye spectrally similar to Cy®5 and Alexa Fluor® 647. CF™640R is much brighter than Cy®5 and at least as bright as Alexa Fluor® 647 when excited at 633 or 635 nm. However, the most important advantage of CF™640R is its exceptional photostability.
Alexa Fluor® is a registered trademark of Thermo Fisher Scientific. Cy®5 is a registered trademark of GE Healthcare.
Catalog Number:
(103007-636)
Supplier:
Anaspec Inc
Description:
Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV Molecular Weight: 4345.9 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(103007-362)
Supplier:
Anaspec Inc
Description:
This peptide amino acids 1 to 17 is a modified fragment of the b-amyloid peptide, with cysteine substituted for valine at position 17.
Sequence: DAEFRHDSGYEVHHQKLC Molecular Weight: 2171.3 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Supplier:
ACROBIOSYSTEMS INC MS
Description:
Human PSGL-1/CD162 Protein, His, Avitag*, Biotinylated, Source: expressed from HEK293. It contains AA Gln 42 - Cys 320, Predicted N-terminus: Gln 42, protein carries a polyhistidine tag at the C-terminus, followed by an Avi tag, Synonyms: PSGL1, CD162, SELPLG, Selectin P ligand, Size: 25uG
Supplier:
Bachem Americas
Description:
Efficient fluorogenic substrate for two matrix metalloproteinases: interstitial collagenase (MMP-1) and gelatinase (MMP-9). Dnp-Pro-Cha-Gly-Cys(Me)-His-Ala-Lys(N-Me-Abz)-amide has favorable solubility characteristics. Both enzymes cleave this substrate between Gly and Cys(Me) (Smc), liberating a cleavage product with a fluorescence signal suitable for inhibitor screening and determining Ki values. The major advantage of this FRET substrate is its adaptability to filters commonly available on commercial plate readers (excitation at 365 nm and emission at 450 nm).
Catalog Number:
(103621-400)
Supplier:
Sino Biological
Description:
The Fc region of mouse IgG1 (P01868-1) (Val 98-Lys 324) (one aa mutation, 102 Cys / Ser) was expressed and purified.
Catalog Number:
(RL605742125)
Supplier:
Rockland Immunochemical
Description:
Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug
Supplier:
AAT BIOQUEST INC
Description:
Cy3 is the least fluorescent dyes among all the Cy dyes.
Catalog Number:
(103225-600)
Supplier:
Novus Biologicals
Description:
TECK Antibody, Polyclonal, Host: Goat, Species reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human CCL25/TECK, Synonym: TECKMGC150327, thymus expressed chemokine, small inducible cytokine subfamily A (Cys-Cys), member 25, Application: WB, Size: 50UG
Catalog Number:
(103621-998)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human PRMT3 (NP_005779.1) (Cys 2-Gln 531) was fused with the GST tag at the N-terminus.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
