Text Search >
1-Bromo-4-(phenoxymethyl)benzene
Print…
You Searched For:
39,106 results were found
1-Bromo-4-(phenoxymethyl)benzene
Catalog Number:
(103623-202)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human UBE2W (Q96B02-12) (Met 1-Cys 151) was expressed, with a polyhistidine tag at the N-terminus.
Catalog Number:
(103622-448)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human IFNA10 (P01566) (Cys 24-Asp 189) was fused with the Fc region of human IgG1 at the N-terminus.
Catalog Number:
(103667-260)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mouse PLA2G1B (NP_035237.1) extracellular domain (Met 1-Cys 146) was fused with a polyhistidine tag at the C-terminus.
Supplier:
Enzo Life Sciences
Description:
The mammalian protein disulphide-isomerase (PDI) family encompasses several highly divergent proteins involved in the processing and maturation of secretory proteins in the ER by catalyzing the rearrangement of disulphide bonds. PDI, an abundant protein of the ER (>400uM), contains a carboxy-terminal retention signal sequence, KDEL, similar to that of BiP and Grp94. The PDI proteins are characterized by the presence of one or more domains of ~95-110 amino acids related to the cytoplasmic protein thioredoxin. All but the PDI-D subfamily are composed entirely of repeats of such domains, with at least one domain containing - and one domain lacking - a redox-active-Cys-X-X-Cys-tetrapeptide. In addition to roles as redox catalysts and isomerases, PDI proteins perform such functions as peptide binding and cell adhesion, and may conduct chaperone activities. Platelet surface thiols and disulphides play an important role in platelet responses. Catalytically active PDI resides on platelet surfaces where it mediates platelet aggregation and secretion by reducing disulfide bonds, thus exposing fibrinogen receptors in platelets.
Catalog Number:
(RL612144120)
Supplier:
Rockland Immunochemical
Description:
Secondary Antibody designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Antibody is suitable for multiplex analysis, including multicolor imaging. Brighter than Alexa and Cy dye conjugates. 100ug
Catalog Number:
(10397-124)
Supplier:
Bioss
Description:
Thioredoxins (Trx) are small, multi-functional proteins with oxidoreductase activity and are ubiquitous in essentially all living cells. Trx contains a redox-active disulfide/dithiol group within the conserved Cys-Gly-Pro-Cys active site. The two cysteine residues in the conserved active centers can be oxidized to form intramolecular disulfide bonds. Reduction of the active site disulfide in oxidized Trx is catalyzed by Trx reductase with NADPH as the electron donor. The reduced Trx is a hydrogen donor for ribonucleotide reductase, the essential enzyme for DNA synthesis, and a potent general protein disulfide reductase with numerous functions in growth and redox regulations. Specific protein disulfide targets for reduction by Trx include protein disulfide isomerase(PDI) and a number of transcription factors such as p53, NF-kB and AP-1. Trx is also capable of removing H2O2, particularly when it is coupled with either methionine sulfoxide reductase or several isoforms of peroxiredoxins.
Catalog Number:
(103621-582)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human MFGE8 isoform 1 (Q08431-1) (Met 1-Cys 387) was fused with a polyhistidine tag at the C-terminus.
Catalog Number:
(76480-730)
Supplier:
AAT BIOQUEST INC
Description:
Cyanines are used in a wide variety of biological applications including comparative genomic hybridization and in gene chips.
Catalog Number:
(10397-120)
Supplier:
Bioss
Description:
Thioredoxins (Trx) are small, multi-functional proteins with oxidoreductase activity and are ubiquitous in essentially all living cells. Trx contains a redox-active disulfide/dithiol group within the conserved Cys-Gly-Pro-Cys active site. The two cysteine residues in the conserved active centers can be oxidized to form intramolecular disulfide bonds. Reduction of the active site disulfide in oxidized Trx is catalyzed by Trx reductase with NADPH as the electron donor. The reduced Trx is a hydrogen donor for ribonucleotide reductase, the essential enzyme for DNA synthesis, and a potent general protein disulfide reductase with numerous functions in growth and redox regulations. Specific protein disulfide targets for reduction by Trx include protein disulfide isomerase(PDI) and a number of transcription factors such as p53, NF-kB and AP-1. Trx is also capable of removing H2O2, particularly when it is coupled with either methionine sulfoxide reductase or several isoforms of peroxiredoxins.
Catalog Number:
(10328-250)
Supplier:
Bioss
Description:
This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. [provided by RefSeq]
Catalog Number:
(10397-122)
Supplier:
Bioss
Description:
Thioredoxins (Trx) are small, multi-functional proteins with oxidoreductase activity and are ubiquitous in essentially all living cells. Trx contains a redox-active disulfide/dithiol group within the conserved Cys-Gly-Pro-Cys active site. The two cysteine residues in the conserved active centers can be oxidized to form intramolecular disulfide bonds. Reduction of the active site disulfide in oxidized Trx is catalyzed by Trx reductase with NADPH as the electron donor. The reduced Trx is a hydrogen donor for ribonucleotide reductase, the essential enzyme for DNA synthesis, and a potent general protein disulfide reductase with numerous functions in growth and redox regulations. Specific protein disulfide targets for reduction by Trx include protein disulfide isomerase(PDI) and a number of transcription factors such as p53, NF-kB and AP-1. Trx is also capable of removing H2O2, particularly when it is coupled with either methionine sulfoxide reductase or several isoforms of peroxiredoxins.
Catalog Number:
(10309-420)
Supplier:
Bioss
Description:
This gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [FUNCTION] Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
Catalog Number:
(RL610744124)
Supplier:
Rockland Immunochemical
Description:
Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug
Supplier:
Anaspec Inc
Description:
This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA MW: 4530.2 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(103010-986)
Supplier:
Anaspec Inc
Description:
Tetramethylrhodamine iodoacetamides (TMRIA) are thiol-selective reactive dyes that are used to label proteins via the cysteine residues. 5-TMRIA, the pure 5-isomer of TMRIA, is increasingly preferred for some particular applications since the mixed isomers of TMRIA may give different results from batch to batch due to the varying ratios and different reactivities of the two isomers. For example, 5-TAMRA is reported to predominantly label SH-1 (Cys-707) of the myosin heavy chain in skinned muscle fibers.
Catalog Number:
(103621-034)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human IFNω (NP_002168.1) (Cys 24-Ser 195) was fused with the Fc region of human IgG1 at the N-terminus.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
