Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Criteria
    • MasterflexLive® (6) C-UL Listed (22) CE Compliant (47) CSA Certified (4) ETL Canada Listed (4) ETL Listed (4) IP55 Washdown (2) IP66 Washdown (14) UL Listed (22) In Stock (53)
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"26"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Thermo Scientific Chemicals
Description:   2,3-O-Isopropylidene-D-ribonic acid-1,4-lactone, 97+%. Powder.
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 60239-18-1
MDL Number: MFCD00068657
Molecular Formula: C16H28N4O8
Molecular Weight: 404.42
Purity/Analysis Method: >97.0% (T)
Form: Crystal
Color: White
Melting point (°C): 267
MSDS SDS
Supplier:  ALADDIN SCIENTIFIC
Description:   Product Describtion:Reagent for the assay of singlett oxygen; it has better characteristics than 9,10-anthracenediyl-bis-dipropionic acid; In addition to the emission maximum at 407 nm, there are lower maxima at 431, 457 and 485 nmA useful O2 determining agent.Product Application:9,10-Anthracenediyl-bis(methylene)dimalonic acid is widely used as a singlet oxygen detector probe. 9,10-Anthracenediyl-bis(methylene)dimalonic acid is suitable for assessing the photodynamic effect of curcumin Vibrio parahaemolyticus, which is a significant cause of bacterial diarrhea
New Product
Supplier:  AMBEED, INC
Description:   trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid (CDTA) 98%
New Product
Supplier:  AMBEED, INC
Description:   2,2-Dimethyl-4,7,10-trioxo-3-oxa-5,8,11-triazatridecan-13-oic acid
Supplier:  AOB CHEM USA
Description:   2-Fluoro-4-formylphenylboronic acid ≥97%
Supplier:  APOLLO SCIENTIFIC
Description:   Isonicotinic acid 99%
Supplier:  BeanTown Chemical
Description:   CAS: 84348-37-8; MDL No: MFCD01860669 Solid; Molecular Formula: C10H15NO5; MW: 229.24 Melting Point: 160° (decomposes) Optical Rotation: [α]22/D +19.0 to +23.0°, c = 0.5 in acetone
MSDS SDS
Supplier:  AMBEED, INC
Description:   2,7-Bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-9,9-di-n-octylfluorene 97%
Catalog Number: (77004-566)

Supplier:  AMBEED, INC
Description:   2,2',2'',2'''-(((3',6'-Dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-2',7'-diyl)bis(methylene))bis(azanetriyl))tetraacetic acid, Purity: AR, CAS: 1461-15-0, Appearance: Yellow to orange to red-brown powder or crytals, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 1MG
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-His(1-Me)-OH
Supplier:  Shenandoah Biotechnology
Description:   Interleukin 22 (IL-22), also called IL-TIF, is an IL-10 family member that is produced by activated dendritic cells and T lymphocytes. IL-22 signals via a heteroduplex receptor consisting of IL-22R and IL-10RB chains. IL-22 is a potent mediator of cellular inflammatory responses and wound healing.  
Catalog Number: (77157-014)

Supplier:  AMBEED, INC
Description:   (9R,9'S)-4,4'-Dihydroxy-10,10'-dioxo-5,5'-bis(((2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)-9,9',10,10'-tetrahydro-[9,9'-bianthracene]-2,2'-dicarboxylic acid, Purity: 95%, CAS Number: 128-57-4, Appearance: Light-yellow to yellow powder or crystals, Size: 1mg
Supplier:  Bachem Americas
Description:   Sequence: H-Trp-OH
Supplier:  BeanTown Chemical
Description:   CAS: 773873-95-3 Liquid; Molecular Formula: C9H6F2O4; MW: 216.14
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16  of 26