Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Boc-Cys(SEt)-OH·DCHA


37,157  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"37157"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Boster Biological Technology
Description:   A ELISA kit containing the core components for developing solid phase sandwich ELISA assay to quantitatively detects ANG in Human samples

Supplier:  VWR
Description:   Examine the Mineral Composition of Igneous Rocks
Catalog Number: (103007-256)

Supplier:  Anaspec Inc
Description:   This synthetic peptide corresponds to ß--Amyloid (1-40) with an additional cysteine at the C-terminus.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Boster Biological Technology
Description:   A ELISA kit containing the core components for developing solid phase sandwich ELISA assay to quantitatively detects Elafin/PI3 in Human samples
Supplier:  IBI Scientific
Description:   0.2mm thick. 96-tooth. Set of two. For the STS 45i Sequencer, IB80000. Specifically designed to be extremely durable and resistant to cracking and warping. Constructed of oxygen-impermeable mylar to allow acrylamide gels to polymerize cleanly against comb.
Supplier:  MilliporeSigma
Description:   A cocktail of six protease inhibitors with broad specificity for the inhibition of aspartic, cysteine, and serine proteases as well as aminopeptidases

Supplier:  SPEX CERTIPREP LLC
Description:   Ion chromatography and ion selective electrode standards.

Supplier:  Sklar
Description:   Sklar's McGivney Hemorrhoid Ligator is an instrument used in one process for the removal of hemorrhoids.
Supplier:  Bachem Americas
Description:   Hepcidin-20, a degradation product of hepcidin-25 found in plasma and urine, shows an increased antimicrobial activity compared to the full-length peptide, but it is not involved in iron metabolism.
Supplier:  Cooper Tools
Description:   Screwdrivers feature chrome-molybdenum-vanadium steel shafts with black oxide tips and rubber-coated, dual-material handles.

Supplier:  Mettler Toledo
Description:   Basic Line weights are protected in robust and easy to clean plastic boxes
Supplier:  Bachem Americas
Description:   Tetralysine.
Supplier:  Baxter
Description:   For use with Baxter irrigating solutions in plastic containers such as UROMATIC or ARTHROMATIC plastic containers.
Catalog Number: (100276-578)

Supplier:  Indofine Chemical Company
Description:   Rare Organics & BioChemicals 5gm 507.6 Room temperature.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Catalog Number: (H-7745.0005BA)

Supplier:  Bachem Americas
Description:   RGES, control peptide for RGDS (H-1155).
Supplier:  SENSEANYWHERE BV
Description:   Optimize the AccessPoint installation with this passive POE splitter. Utilizing a white cable set, it efficiently combines and splits data and power at the switch and AccessPoint, respectively. Designed for setups without POE-enabled switches, it ensures a unified, hassle-free connection with a standard ethernet cable.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,905 - 5,920  of 37,157