Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2-Chloro-4-phenylnicotinonitrile


1,178  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"1178"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Restek
Description:   Contains: Benzene (71-43-2); Bromobenzene (108-86-1); Bromochloromethane (74-97-5); Bromodichloromethane (75-27-4); Bromoform (75-25-2); n-Butylbenzene (104-51-8); sec-Butylbenzene (135-98-8); tert-Butylbenzene (98-06-6); Carbon tetrachloride (56-23-5); Chlorobenzene (108-90-7); Chloroform (67-66-3); 2-Chlorotoluene (95-49-8); 4-Chlorotoluene (106-43-4); Dibromochloromethane (124-48-1); 1,2-Dibromo-3-chloropropane (DBCP) (96-12-8); 1,2-Dibromoethane (EDB) (106-93-4); Dibromomethane (74-95-3); 1,2-Dichlorobenzene (95-50-1); 1,3-Dichlorobenzene (541-73-1); 1,4-Dichlorobenzene (106-46-7); 1,1-Dichloroethane (75-34-3); 1,2-Dichloroethane (107-06-2); 1,1-Dichloroethene (75-35-4); cis-1,2-Dichloroethene (156-59-2); trans-1,2-Dichloroethene (156-60-5); 1,2-Dichloropropane (78-87-5); 1,3-Dichloropropane (142-28-9); 2,2-Dichloropropane (594-20-7); 1,1-Dichloropropene (563-58-6); cis-1,3-Dichloropropene (10061-01-5); trans-1,3-Dichloropropene (10061-02-6); Ethylbenzene (100-41-4); Hexachloro-1,3-butadiene (hexachlorobutadiene) (87-68-3); Isopropylbenzene (cumene) (98-82-8); 4-Isopropyltoluene (p-cymene) (99-87-6); Methylene chloride (dichloromethane) (75-09-2); Naphthalene (91-20-3); n-Propylbenzene (103-65-1); Styrene (100-42-5); 1,1,1,2-Tetrachloroethane (630-20-6); 1,1,2,2-Tetrachloroethane (79-34-5); Tetrachloroethene (127-18-4); Toluene (108-88-3); 1,2,3-Trichlorobenzene (87-61-6); 1,2,4-Trichlorobenzene (120-82-1); 1,1,1-Trichloroethane (71-55-6); 1,1,2-Trichloroethane (79-00-5); Trichloroethene (79-01-6); 1,2,3-Trichloropropane (96-18-4); 1,2,4-Trimethylbenzene (95-63-6); 1,3,5-Trimethylbenzene (108-67-8); m-Xylene (108-38-3); o-Xylene (95-47-6); p-Xylene (106-42-3)
MSDS SDS
Supplier:  Matrix Scientific
Description:   1-Phenyl-1H-pyrazol-3-amine
Catalog Number: (ABCA_AB279735-1X96)

Supplier:  ABCAM INC.
Description:   Phospho-Amyloid Precursor Protein (T668) ELISA Kit
New Product
Supplier:  Wearwell
Description:   Combats fatigue while providing a top to bottom anti-microbial solution.
Catalog Number: (102668-112)

Supplier:  Matrix Scientific
Description:   Ethyl [(1-ethylpropyl)amino](oxo)acetate

Supplier:  Bioss
Description:   AM and PAMP are potent hypotensive and vasodilatator agents. Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, am is diuretic and natriuretic, and both am and pamp inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.

Supplier:  Bioss
Description:   AM and PAMP are potent hypotensive and vasodilatator agents. Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, am is diuretic and natriuretic, and both am and pamp inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.
Supplier:  AMBEED, INC
Description:   (4-(((tert-Butoxycarbonyl)(methyl)amino)methyl)phenyl)boronic acid 98%

Supplier:  Electron Microscopy Sciences
Description:   This Chuck Adapter machined to fit Shandon and Ames / Tissue-Tek cryostats.
Supplier:  Hardy Diagnostics
Description:   HardyDiskâ„¢ AST’s are impregnated paper disks used for Antimicrobial Susceptibility Testing (AST).
Product available on GSA Advantage®

Supplier:  ABCAM INC.
Description:   Human D Amino Acid Oxidase Antibody Pair - BSA and Azide free
New Product
Catalog Number: (76009-660)

Supplier:  Prosci
Description:   UPF2 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located in the perinuclear area. It interacts with translation release factors and the proteins that are functional homologs of yeast Upf1p and Upf3p.
Supplier:  HITACHI HIGH-TECH AMERICA, INC.
Description:   The Primaideâ„¢ is a standard HPLC system designed and manufactured to the highest quality by Hitachi. Suitable for academic and other small laboratories that need a sturdy and reliable standard HPLC system.
Catalog Number: (76848-010)

Supplier:  Qorpak
Description:   Amber glass jugs with molded finger grips are the perfect storage solution for light sensitive products.
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  Abnova
Description:   Mouse monoclonal antibody raised against macrophage surface antigen.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
337 - 352  of 1,178