Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Calbryte\u2122+630+AM


1,178  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"1178"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Ohaus
Description:   Top-of-the-line compact scales for even the most complex industrial applications. Simplify complex applications and minimize the need for manual calculations with ten advanced application modes, peripheral device control and an optional kit for a second scale platform.
Catalog Number: (103003-154)

Supplier:  Anaspec Inc
Description:   Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.
Sequence:YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
MW:6028.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  Qorpak
Description:   Amber screw thread sample vials offer protection from harmful light and UV rays for light sensitive products.
Small Business Enterprise
Supplier:  AMBEED, INC
Description:   (R)-Dimethyl 2-((tert-butoxycarbonyl)amino)pentanedioate 97%
Supplier:  Thermo Scientific Chemicals
Description:   50G
MSDS SDS
Catalog Number: (220010-063)

Supplier:  R&D Systems
Description:   Anti-ITGAM Goat Polyclonal Antibody
Supplier:  Wearwell
Description:   Rejuvenator® workstation mats provide superior anti-fatigue benefits and long-term performance.
Supplier:  Biotium
Description:   Nerve terminal probes are a series of fluorescent cationic styryl dyes developed to follow synaptic activity
Supplier:  Adipogen
Description:   Setomimycin is a 9,9`-Bianthryl polyketide derivative.
Catalog Number: (76009-520)

Supplier:  Prosci
Description:   Regulator of deubiquitinating complexes. Acts as a strong activator of USP1 by enhancing the USP1-mediated deubiquitination of FANCD2; USP1 being almost inactive by itself. Also activates deubiquitinating activity of complexes containing USP12 and USP46, respectively. Activates deubiquitination by increasing the catalytic turnover without increasing the affinity of deubiquitinating enzymes for the substrate. In case of infection by Herpesvirus saimiri, may play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes. Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein (TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptor TCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP. In case of infection by papillomavirus HPV11, promotes the maintenance of the viral genome via its interaction with HPV11 helicase E1.
Catalog Number: (102835-026)

Supplier:  Matrix Scientific
Description:   6-Amino-3-chloro-1H-indazole ≥97%

Supplier:  R&D Systems
Description:   Anti-ITGAM Mouse Monoclonal Antibody [clone: 238446]
Catalog Number: (76745-834)

Supplier:  ANTIBODIES.COM LLC
Description:   Mouse CXCL9 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse CXCL9 in serum, plasma, tissue homogenates, and other biological fluids.

Supplier:  R&D Systems
Description:   Anti-ITGAM Mouse Monoclonal Antibody [clone: 238439]
Catalog Number: (AAJ64180-A1)

Supplier:  Thermo Scientific Chemicals
Description:   Crystalline
MSDS SDS
Supplier:  AAT BIOQUEST INC
Description:   Staurosporine is widely used as a positive control for inducing apoptosis.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
465 - 480  of 1,178
Prev   30  31  32  33  34  35  36  37  38  39  40  41  42  43  44  45  Next