Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Dimethyl-2,2-dimethylpentanedioate


25,329  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"25329"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   tert-Butyl-4-(5,5-dimethyl-2-oxo-1,3-oxazinan-3-yl)piperidine-1-carboxylate ≥97%
Supplier:  AOB CHEM USA
Description:   1-Isobutyl-3,5-dimethyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole ≥97%
Supplier:  Matrix Scientific
Description:   Ethyl [4-(4-chlorophenyl)-2,4-dimethyl-3,4-dihydroquinolin-1(2H)-yl](oxo)acetate
Supplier:  AMBEED, INC
Description:   (S)-3,3'-Bis(2-naphthyl)-5,5',6,6',7,7',8,8'-octahydro-1,1'-binaphthyl-2,2'-diyl Hydrogen Phosphate, Purity: 98%, CAS Number: 2249931-95-9, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 100MG
Supplier:  TCI America
Description:   CAS Number: 180186-94-1
MDL Number: MFCD06797115
Molecular Formula: C21H18N2O2
Molecular Weight: 330.39
Purity/Analysis Method: >98.0% (HPLC,N)
Form: Crystal
Melting point (°C): 225
Specific rotation [a]20/D: 360 deg (C=1, CH2Cl2)
MSDS SDS
Supplier:  AMBEED, INC
Description:   (1S,1'S)-1,1'-Bis[bis[3,5-bis(trifluoromethyl)phenyl]phosphino]-2,2'-bis[(S)-(dimethylamino)phenylmethyl]ferrocene, Purity: 98%, CAS Number: 849925-10-6, Appearance: Form: powder Colour: orange, Storage: Inert atmosphere, 2-8 C, Size: 100mg
Supplier:  AMBEED, INC
Description:   (1R)-1-[Bis(4-methoxy-3,5-dimethylphenyl)phosphino]-2-[(1R)-1-(dicyclohexylphosphino)ethyl]ferrocene, Purity: 98% 99%ee, CAS Number: 360048-63-1, Appearance: Form: powder Colour: yellow to orange, Storage: Inert atmosphere, 2-8 C, Size: 100mg
Supplier:  AMBEED, INC
Description:   (4S,4'S)-1,1'-Di([1,1'-biphenyl]-4-yl)-4,4'-diisopropyl-4,4',5,5'-tetrahydro-1H,1'H-2,2'-biimidazole ≥97%
New Product
Supplier:  AMBEED, INC
Description:   2-Amino-1-(3-((4-chlorophenyl)amino)-2-(4-fluorophenyl)-8,8-dimethyl-5,6-dihydroimidazo[1,2-a]pyrazin-7(8H)-yl)ethanone, Purity: 98+%, CAS: 1261114-01-5, Appearance: White to light-yellow powder or crystals, Storage: Keep in dark place, Inert atmosphere, Store in freezer, under -20 C, Size: 1mg
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 040577-500MG , MDL Number: MFCD12028285
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 064862-500MG , MDL Number: MFCD05673338
Supplier:  Matrix Scientific
Description:   MF=C12H22Cl2N4O2 MW=325.24 ,500Mg
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 040264-500MG , MDL Number: MFCD12028160
Supplier:  AMBEED, INC
Description:   (5S)-6,6'-Bis(bis(3,5-dimethylphenyl)phosphaneyl)-2,2',3,3'-tetrahydro-5,5'-bibenzo[b][1,4]dioxine ≥97%
New Product
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 036467-500MG , MDL Number: MFCD12026911
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,593 - 6,608  of 25,329